PRGDB00078860 (Vvi.15723)

From PRG Wiki
Jump to: navigation, search
Vvi.15723
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 225427592 (XM_002270497)
Gene Class CN
Domain Type NBS
Gene Species Vitis vinifera

Comment?

PREDICTED: Vitis vinifera hypothetical protein LOC100247745 (LOC100247745), mRNA

DNA Sequence

ATGCCCCTCAACTGCATAGCCCCAAAACCGGAAAATCAAGGCAACATCCCCATGGAAGGTTTGTCCAGGACATCTGAATCCGACAACTCAGCCGTCCTTACCTACCCCATGCAAACCAATTCACAATCTATTCTACAACACACCTTGTACTCCATAAATCTCAAGTTTGAAGAGGTCGTTTACAAAGTTAAATTAGAGCAGAAAGGGTTTTGCTGGGGGGGTGCATGGAGCACCAGAGACAAGACAATACTGAATGGAATAACAGGCATGGTTTGTCCAGGAGAGATACTAGCGATGTTAGGGCCATCTGGGAGCGGCAAAACCACACTCCTTACAGCCCTTGGAGGCCGTCTCAATGGTAAGTTATCAGGCAAGATCACGTACAATGGTCAGCCTTTCTCTGGCGCTGTCAAACGAAGAACAGGATTTGTTGCACAGGACGATGTTCTCTACCCGCATCTTACTGTAACTGAAACCCTCCTATTCACTGCACTGCTAAGGCTGCCAAAAAGCTTGGCACGAAATGAGAAAGCCCAGCATGTGGAGAGGGTCATCTCTGAGTTGGGATTAACACGGTGTCGGAACAGCATGATTGGGGGACCTCTCTTTAGGGGCATATCAGGTGGGGAGAAGAAGAGGGTGAGCATAGGCCAAGAAATGCTAATCAACCCAAGCTTGCTGTTGCTAGATGAGCCCACCTCAGGTTTGGACTCGACCACTGCTCAACGGATCCTAACCACCATTAAACGACTGGCTAGTGGGGGTAGAACCGTGGTCACCACTATTCACCAGCCCTCAAGCCGCCTCTACCACATGTTTGATAAGGTAATCTTGCTTTCTGAGGGCTGCCCCATCTACAATGGTCCTGCATCAACTGCCATGGAATACTTCTCCTCAGTTGGTTTCTCCACATGCGTGACTGTCAATCCAGCTGATCTCTTACTCGATCTTGCTAACGGAATTAGCCCTGATTCCAAGCAAGCAGCGGAGCAAAGTGAGAACATGGAACAAGAGCAGAAGTCAGTGAGAGAAGCTCTCATCTCCGCCTATGAAAAGAACATTTCTACTAGGCTGAAAGCCGAGCTCTGCAGTGTGGATGTCAATAACTACAATTATACAAAGGACGGTCGAAATAACTTCAAGGCAGATCAATGGTGCACAAGCTGGTGGCATCAGTTCATGGTGCTGCTTCAGAGGGGACTAAGGGAAAGGAGGTACGAAGCCTTCAACAGGCTAAGAATCTTCCAAGTCATAAGTGTCGCTGTGCTAGGCGGTCTTCTATGGTGGCACACCCCAACATCCCACATTGAGGATCGAATAGCCCTGCTCTTCTTCTTCTCTGTGTTCTGGGGGTTCTACCCACTCTACAATGCAGTCTTTACATTTCCCCAAGAAAGAAGAATGCTGATCAAGGAACGATCATCTGGCATGTACCGCCTTTCATCATACTTTCTAGCCAGAACTTTTGGAGACCTGCCACTTGAGCTTGCTCTCCCAACAGCCTTTGTCATCATAATCTACTGGATGGGTGGACTAAAACCTGATCCCATCACTTTCATCCTTTCTCTTCTTGTCGTTCTCTACAATGTCCTTGTCTCCCAAAGTCTGGGCTTAGCCATTGGCGCAATACTGATGGACATAAAACAAGCAACTACTTTAGCCTCTGTTACAACCCTAGTGTTCCTGATCGCGGGCGGATACTATGTGCAACAAATCCCTCCCTTCATTGTCTGGCTAAAGTACTTGAGCTATAGCTACTACTGCTATAAGCTTCTCCTCGGGATACAGTACAGCGAGGATGACTACTACGAGTGCTCCAAGGGGGTGTTTTGTCGGGTTGTAGATTTTCCTGCAGTCAAATCCGTGGGGCTCAACCATTTGTGGATTGATGTGTGCATTATGGCCCTGATGTTGGTGGGGTATCGACTTGTTGCTTATCTGGCATTGCATCGGGTACAGTTGAGGTGAGTCTAGCAGAGTACCCATCACTCATCACCCTTTACCCATTACATCAAACAAGGCAGTTCGAAGAGTTTTCTCCTTCTTCAACTGAGGAATAATGTTAGATTTTAGATGGAAATCATGTTCCATTTCCACCATTTTCACTCAGAAGACTTGGATATGTACTACTGGCCTTTCTATCCGTGACAGTATAGACAATAGTAAAAAATTCTACTGCTACTCCATCGACAACTCGAGCCTTATCAATGTATGTGAGGCTAGGATTCAAAA


Protein sequences

Name Description Sequence
Vvi.15723 translated coding region predicted by ESTScan from UniGene Vvi.15723

MPLNCIAPKPENQGNIPMEGLSRTSESDNSAVLTYPMQTNSQSILQHTLYSINLKFEEVVYKVKLEQKGFCWGGAWSTRDKTILNGITGMVCPGEILAMLGPSGSGKTTLLTALGGRLNGKLSGKITYNGQPFSGAVKRRTGFVAQDDVLYPHLTVTETLLFTALLRLPKSLARNEKAQHVERVISELGLTRCRNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTAQRILTTIKRLASGGRTVVTTIHQPSSRLYHMFDKVILLSEGCPIYNGPASTAMEYFSSVGFSTCVTVNPADLLLDLANGISPDSKQAAEQSENMEQEQKSVREALISAYEKNISTRLKAELCSVDVNNYNYTKDGRNNFKADQWCTSWWHQFMVLLQRGLRERRYEAFNRLRIFQVISVAVLGGLLWWHTPTSHIEDRIALLFFFSVFWGFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVIIIYWMGGLKPDPITFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQQIPPFIVWLKYLSYSYYCYKLLLGIQYSEDDYYECSKGVFCRVVDFPAVKSVGLNHLWIDXVHYGPDVGGVSTCCLSGIASGTVEVSLAEYPSLITLYPLHQTRQFEEFSPSSTEE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241:SF23
6-630 ATP-BINDING CASSETTE TRANSPORTER,ATP-BINDING CASSETTE TRANSPORTER

IAPKPENQGNIPMEGLSRTSESDNSAVLTYPMQTNSQSILQHTLYSINLKFEEVVYKVKLEQKGFCWGGAWSTRDKTILNGITGMVCPGEILAMLGPSGSGKTTLLTALGGRLNGKLSGKITYNGQPFSGAVKRRTGFVAQDDVLYPHLTVTETLLFTALLRLPKSLARNEKAQHVERVISELGLTRCRNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTAQRILTTIKRLASGGRTVVTTIHQPSSRLYHMFDKVILLSEGCPIYNGPASTAMEYFSSVGFSTCVTVNPADLLLDLANGISPDSKQAAEQSENMEQEQKSVREALISAYEKNISTRLKAELCSVDVNNYNYTKDGRNNFKADQWCTSWWHQFMVLLQRGLRERRYEAFNRLRIFQVISVAVLGGLLWWHTPTSHIEDRIALLFFFSVFWGFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVIIIYWMGGLKPDPITFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQQIPPFIVWLKYLSYSYYCYKLLLGIQYSEDDYYECSKGVFCRVVDFPAVKSVGLNHLWID

HMMPanther: PTHR19241
6-630 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

IAPKPENQGNIPMEGLSRTSESDNSAVLTYPMQTNSQSILQHTLYSINLKFEEVVYKVKLEQKGFCWGGAWSTRDKTILNGITGMVCPGEILAMLGPSGSGKTTLLTALGGRLNGKLSGKITYNGQPFSGAVKRRTGFVAQDDVLYPHLTVTETLLFTALLRLPKSLARNEKAQHVERVISELGLTRCRNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTAQRILTTIKRLASGGRTVVTTIHQPSSRLYHMFDKVILLSEGCPIYNGPASTAMEYFSSVGFSTCVTVNPADLLLDLANGISPDSKQAAEQSENMEQEQKSVREALISAYEKNISTRLKAELCSVDVNNYNYTKDGRNNFKADQWCTSWWHQFMVLLQRGLRERRYEAFNRLRIFQVISVAVLGGLLWWHTPTSHIEDRIALLFFFSVFWGFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVIIIYWMGGLKPDPITFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQQIPPFIVWLKYLSYSYYCYKLLLGIQYSEDDYYECSKGVFCRVVDFPAVKSVGLNHLWID

ProfileScan: PS50893
IPR003439
54-306 ABC_TRANSPORTER_2
ABC transporter-like

LKFEEVVYKVKLEQKGFCWGGAWSTRDKTILNGITGMVCPGEILAMLGPSGSGKTTLLTALGGRLNGKLSGKITYNGQPFSGAVKRRTGFVAQDDVLYPHLTVTETLLFTALLRLPKSLARNEKAQHVERVISELGLTRCRNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTAQRILTTIKRLASGGRTVVTTIHQPSSRLYHMFDKVILLSEGCPIYNGPASTAMEYFSSVGFSTCV

superfamily: SSF52540
63-292 P-loop containing nucleoside triphosphate hydrolases

VKLEQKGFCWGGAWSTRDKTILNGITGMVCPGEILAMLGPSGSGKTTLLTALGGRLNGKLSGKITYNGQPFSGAVKRRTGFVAQDDVLYPHLTVTETLLFTALLRLPKSLARNEKAQHVERVISELGLTRCRNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTAQRILTTIKRLASGGRTVVTTIHQPSSRLYHMFDKVILLSEGCPIYNGPAST

Gene3D: G3DSA:3.40.50.300
79-316 no description

RDKTILNGITGMVCPGEILAMLGPSGSGKTTLLTALGGRLNGKLSGKITYNGQPFSGAVKRRTGFVAQDDVLYPHLTVTETLLFTALLRLPKSLARNEKAQHVERVISELGLTRCRNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTAQRILTTIKRLASGGRTVVTTIHQPSSRLYHMFDKVILLSEGCPIYNGPASTAMEYFSSVGFSTCVTVNPADLLLD

HMMSmart: SM00382
IPR003593
93-283 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PGEILAMLGPSGSGKTTLLTALGGRLNGKLSGKITYNGQPFSGAVKRRTGFVAQDDVLYPHLTVTETLLFTALLRLPKSLARNEKAQHVERVISELGLTRCRNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTAQRILTTIKRLASGGRTVVTTIHQPSSRLYHMFDKVILLSEGC

HMMPfam: PF00005
IPR003439
108-234 ABC_tran
ABC transporter-like

TTLLTALGGRLNGKLSGKITYNGQPFSGAVKRRTGFVAQDDVLYPHLTVTETLLFTALLRLPKSLARNEKAQHVERVISELGLTRCRNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTS

PatternScan: PS00211
IPR017871
206-220 ABC_TRANSPORTER_1
ABC transporter, conserved site

ISGGEKKRVSIGQEM

Coil: coil
325-346 coiled-coil

SKQAAEQSENMEQEQKSVREAL

HMMPfam: PF01061
IPR013525
392-597 ABC2_membrane
ABC-2 type transporter

QFMVLLQRGLRERRYEAFNRLRIFQVISVAVLGGLLWWHTPTSHIEDRIALLFFFSVFWGFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVIIIYWMGGLKPDPITFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQQIPPFIVWLKYLSYSYYCYKLLLGIQY

Seg: seg
521-536 seg

LSLLVVLYNVLVSQSL

Seg: seg
579-593 seg

LKYLSYSYYCYKLLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox