PRGDB00078871 (Vvi.16247)

From PRG Wiki
Jump to: navigation, search
Vvi.16247
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 225460154 (XM_002276166)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Vitis vinifera

Comment?

PREDICTED: Vitis vinifera hypothetical protein LOC100263726 (LOC100263726), mRNA

DNA Sequence

ATGGCTTCTGCGGCTGCTGCTTCTTCTTCTTCTCAAAGGCGCTATGATGTGTTCCTCAGCTTCAGAGGAGAAGACACCCGCAATAACTTCACTGCCCATCTCTATCACGCCTTGTGCCAGAAAGGAATCAACACTTTCATCGATGATGACAAGCTTGAGAGAGGCCAAGTCATATCTCCTGCCCTTGTTGCAGCTATCGAAAACTCCATGTATTCGATAGTTGTTTTGTCGAAAAATTATGCATCCTCTAGATGGTGTTTACAGGAATTGGTGAAGATAGTAGAGTGCATGAAAAGCAAGAGACAGATGGTTTTCCCAATTTTCTACGATGTGGATCCCTCGGAAGTGAGAAGACACAGGGGTACATTTGGGGAAGCATTGGCTAAACATGAAGAGAACTCTGAGAACATGGAGAGGGTGGAGAGTTGGAAGGATGCTCTCACTCAAGTTGCAAATTTATCTGGTTGGGATTCAAGAAATAAGAATGAGCATCTACTAATCAAGGGAATCGTCACAGATATTTTGAATAAGTTGTTAACTACATCTATTAGTGATACCGTAAATTTGGTTGGAATAGATGCTCGCATGCAAGAAATAGAAATGCGATTATGTTTGGAGTTTGATGATTTTCTGATGGTAGGAATTTGGGGCATGGGCGGAATAGGGAAAACAACCCTTGCTAGAGCTATTTACAGAAAAATCAGGGGTCAATTTGAAGCATGCTGTTTTTTTGAAAATGTTGAGGAGGATTTGGCAAATGAGGGTTTAATAAAATTACAACAAAAGTTTCTAGCTCAACTATTGGAGGAACCAAATCTAAATATGAAGGCACTCACATCTATAAAGGAAAGGCTCCACTTGAAAAAAGTCCTTATTGTTCTTGATAATGTGAATGATCCAATAATATTGAAATGCTTGGTTGGAAACCGGGATTGGTTTGGTCAAGGAAGTAGAATTATTATAACCACTAGGGATGAACGTTTGTTAATTTCACATGGAGTACTCAATTGTTATGAGGCTCGGAGATTTAATTATGATGAAGCTAAAAGGTTCCTTTCACATTATTTGTTAAAACATGAAATTCTTAGAGATGATTTCATTGAACTTTCAAGAGAAGTAATAGGTTATGCTCAAGGCCTCCCATTGGCTCTAGAAGTTTTAGGTTCTTTTTTATTTAGCATGACCAAAGAAGAATGGAGAAATCAATTAGACAAACTGAAAAGTACCCCTAATATGAAAATTCAAGAAGTACTTAAAGTAAGTTATAAGGGGCTAGATGATAAGGAGAAGAATATATTTCTAGACATTGCATGTTTCTTTAAAGGAGAGGATAAAGATTATGTAATGGAAATACTAGATGGTTGCGGCTTCTTCTCACTTAGTGGAATACGAGCTCTCATTGAGAAGACACTCATAACTATTTCTTGGAATAATAAGTTAATGATGCATGACTTGATACAAGAAATGGGAAGGGAAATTGTTCGTCAACAATCCCTTGAAGAGCCTAGTAAACGCAGTAGATTATGGTTCCATGAAGATATCTATGATGTATTGCAAAAAAATACGGCAACTGAAAAAATTGAAGGCATATTCCTCAACTTGTCTCATTTAGAAGAGATGCTAGACTTTACCACTCAAGCCCTTGCAAGGATGAATAGACTTAGATTGCTCAAAGTTCTTGAAAAGTTAAAATTCATGGATCTCAGTCACTCCAAGTACTTAATAGAAACTCCAAATTTTCAAGGAGTCACCAACCTTAAGCGGTTAGTTTTGGAAGACTGTGTGTCTTTACGTAAGGTTCATTCATCACTTGGAGATCTGAAGAATCTTAGTTTCTTGAATTTGAAAAATTGCAAAATGCTAAAGAGTCTTCCAAGCAGCACTTGTGATTTGAAATCTCTTGAAACATTTATTCTTTCTGGTTGCTCCAAATTTGAAGGATTTCCTGAGAACTTTGGAAGCTTAGAAATGTTGAAGGAACTTTATGCAGATGAAATTGCTATAAGAGGTTACTTCGTGGCATCAATAGCATCAATGGCATTTATTCCTGGAAGTAGAATACCTGATTGGGTAACATATCAAAGCTCAGGGAGTGAAGTAAAAGCAGAGCTACCTCCAAATTGGTTTAATTCCAACCTTCTGGGTTTTGCTTTGAGTGTTGTCATTTTTCCCCAAGTCTGCTACTCGACCATTGTTTCAATGACGGTCTCATTTGACAATTCTTCCTCCTTTGAAATCGGTCCTCGTATGCTTCACTTTAATGGAAGGTTGGAGTCGGATCACGTGTGCCTGTTTTATTTACGACTTCACCAGCTGATGAGCAATTGCTCTCAAGTGACTCGCTTGAAGATATCATTTAAAACATTCCCCATGGGGGGTCAGATTGAAATTAAGAGGTGTGGGGTTGGTCTAGTGTACAGTAATGAAGATGGGGTAGGCGACAGTCCCCCAATGATCCAATTCAACTCTAtctcctctcctcctccccctccccctcctcctAATAAGTCAACTGTTGTCCTTGAAGAAATCCATGAGGGGGAACCCAGTGGAAATGGGTGCTCTAATGTTGATGGCTCAGAAGAAGAGAATTCTGAATACCATACTGCTGATGAGGAGGAACCCAGTACTGCAACTGCCTGCTCTGAGGATCACTCTGAATCAGTTATGCGGCCACAGAAACGCTTGAAATGCAGGCATTAA


Protein sequences

Name Description Sequence
Vvi.16247 translated coding region predicted by ESTScan from UniGene Vvi.16247

MASAAAASSSSQRRYDVFLSFRGEDTRNNFTAHLYHALCQKGINTFIDDDKLERGQVISPALVAAIENSMYSIVVLSKNYASSRWCLQELVKIVECMKSKRQMVFPIFYDVDPSEVRRHRGTFGEALAKHEENSENMERVESWKDALTQVANLSGWDSRNKNEHLLIKGIVTDILNKLLTTSISDTVNLVGIDARMQEIEMRLCLEFDDFLMVGIWGMGGIGKTTLARAIYRKIRGQFEACCFFENVEEDLANEGLIKLQQKFLAQLLEEPNLNMKALTSIKERLHLKKVLIVLDNVNDPIILKCLVGNRDWFGQGSRIIITTRDERLLISHGVLNCYEARRFNYDEAKRFLSHYLLKHEILRDDFIELSREVIGYAQGLPLALEVLGSFLFSMTKEEWRNQLDKLKSTPNMKIQEVLKVSYKGLDDKEKNIFLDIACFFKGEDKDYVMEILDGCGFFSLSGIRALIEKTLITISWNNKLMMHDLIQEMGREIVRQQSLEEPSKRSRLWFHEDIYDVLQKNTATEKIEGIFLNLSHLEEMLDFTTQALARMNRLRLLKVLEKLKFMDLSHSKYLIETPNFQGVTNLKRLVLEDCVSLRKVHSSLGDLKNLSFLNLKNCKMLKSLPSSTCDLKSLETFILSGCSKFEGFPENFGSLEMLKELYADEIAIRGYFVASIASMAFIPGSRIPDWVTYQSSGSEVKAELPPNWFNSNLLGFALSVVIFPQVCYSTIVSMTVSFDNSSSFEIGPRMLHFNGRLESDHVCLFYLRLHQLMSNCSQVTRLKISFKTFPMGGQIEIKRCGVGLVYSNEDGVGDSPPMIQFNSISSPPPPPPPPNKSTVVLEEIHEGEPSGNGCSNVDGSEEENSEYHTADEEEPSTATACSEDHSESVMRPQKRLKCRH

Domains

Domain Start-End Description Sequence

Seg: seg
2-11 seg

ASAAAASSSS

superfamily: SSF52200
IPR000157
3-156 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

SAAAASSSSQRRYDVFLSFRGEDTRNNFTAHLYHALCQKGINTFIDDDKLERGQVISPALVAAIENSMYSIVVLSKNYASSRWCLQELVKIVECMKSKRQMVFPIFYDVDPSEVRRHRGTFGEALAKHEENSENMERVESWKDALTQVANLSGW

Gene3D: G3DSA:3.40.50.10140
10-147 no description

SSQRRYDVFLSFRGEDTRNNFTAHLYHALCQKGINTFIDDDKLERGQVISPALVAAIENSMYSIVVLSKNYASSRWCLQELVKIVECMKSKRQMVFPIFYDVDPSEVRRHRGTFGEALAKHEENSENMERVESWKDAL

ProfileScan: PS50104
IPR000157
13-153 TIR
Toll-Interleukin receptor

RRYDVFLSFRGEDTRNNFTAHLYHALCQKGINTFIDDDKLERGQVISPALVAAIENSMYSIVVLSKNYASSRWCLQELVKIVECMKSKRQMVFPIFYDVDPSEVRRHRGTFGEALAKHEENSENMERVESWKDALTQVANL

HMMSmart: SM00255
IPR000157
14-153 Toll
Toll/interleukin-1 receptor homology (TIR) domain

RYDVFLSFRGEDTRNNFTAHLYHALCQKGINTFIDDDKLERGQVISPALVAAIENSMYSIVVLSKNYASSRWCLQELVKIVECMKSKRQMVFPIFYDVDPSEVRRHRGTFGEALAKHEENSENMERVESWKDALTQVANL

HMMPfam: PF01582
IPR000157
17-148 TIR
Toll-Interleukin receptor

VFLSFRGEDTRNNFTAHLYHALCQKGINTFIDDDKLERGQVISPALVAAIENSMYSIVVLSKNYASSRWCLQELVKIVECMKSKRQMVFPIFYDVDPSEVRRHRGTFGEALAKHEENSENMERVESWKDALT

HMMPanther: PTHR11017:SF20
38-669 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LCQKGINTFIDDDKLERGQVISPALVAAIENSMYSIVVLSKNYASSRWCLQELVKIVECMKSKRQMVFPIFYDVDPSEVRRHRGTFGEALAKHEENSENMERVESWKDALTQVANLSGWDSRNKNEHLLIKGIVTDILNKLLTTSISDTVNLVGIDARMQEIEMRLCLEFDDFLMVGIWGMGGIGKTTLARAIYRKIRGQFEACCFFENVEEDLANEGLIKLQQKFLAQLLEEPNLNMKALTSIKERLHLKKVLIVLDNVNDPIILKCLVGNRDWFGQGSRIIITTRDERLLISHGVLNCYEARRFNYDEAKRFLSHYLLKHEILRDDFIELSREVIGYAQGLPLALEVLGSFLFSMTKEEWRNQLDKLKSTPNMKIQEVLKVSYKGLDDKEKNIFLDIACFFKGEDKDYVMEILDGCGFFSLSGIRALIEKTLITISWNNKLMMHDLIQEMGREIVRQQSLEEPSKRSRLWFHEDIYDVLQKNTATEKIEGIFLNLSHLEEMLDFTTQALARMNRLRLLKVLEKLKFMDLSHSKYLIETPNFQGVTNLKRLVLEDCVSLRKVHSSLGDLKNLSFLNLKNCKMLKSLPSSTCDLKSLETFILSGCSKFEGFPENFGSLEMLKELYADEIAIR

HMMPanther: PTHR11017
38-669 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LCQKGINTFIDDDKLERGQVISPALVAAIENSMYSIVVLSKNYASSRWCLQELVKIVECMKSKRQMVFPIFYDVDPSEVRRHRGTFGEALAKHEENSENMERVESWKDALTQVANLSGWDSRNKNEHLLIKGIVTDILNKLLTTSISDTVNLVGIDARMQEIEMRLCLEFDDFLMVGIWGMGGIGKTTLARAIYRKIRGQFEACCFFENVEEDLANEGLIKLQQKFLAQLLEEPNLNMKALTSIKERLHLKKVLIVLDNVNDPIILKCLVGNRDWFGQGSRIIITTRDERLLISHGVLNCYEARRFNYDEAKRFLSHYLLKHEILRDDFIELSREVIGYAQGLPLALEVLGSFLFSMTKEEWRNQLDKLKSTPNMKIQEVLKVSYKGLDDKEKNIFLDIACFFKGEDKDYVMEILDGCGFFSLSGIRALIEKTLITISWNNKLMMHDLIQEMGREIVRQQSLEEPSKRSRLWFHEDIYDVLQKNTATEKIEGIFLNLSHLEEMLDFTTQALARMNRLRLLKVLEKLKFMDLSHSKYLIETPNFQGVTNLKRLVLEDCVSLRKVHSSLGDLKNLSFLNLKNCKMLKSLPSSTCDLKSLETFILSGCSKFEGFPENFGSLEMLKELYADEIAIR

superfamily: SSF52540
172-414 P-loop containing nucleoside triphosphate hydrolases

TDILNKLLTTSISDTVNLVGIDARMQEIEMRLCLEFDDFLMVGIWGMGGIGKTTLARAIYRKIRGQFEACCFFENVEEDLANEGLIKLQQKFLAQLLEEPNLNMKALTSIKERLHLKKVLIVLDNVNDPIILKCLVGNRDWFGQGSRIIITTRDERLLISHGVLNCYEARRFNYDEAKRFLSHYLLKHEILRDDFIELSREVIGYAQGLPLALEVLGSFLFSMTKEEWRNQLDKLKSTPNMKI

Gene3D: G3DSA:3.40.50.300
188-331 no description

NLVGIDARMQEIEMRLCLEFDDFLMVGIWGMGGIGKTTLARAIYRKIRGQFEACCFFENVEEDLANEGLIKLQQKFLAQLLEEPNLNMKALTSIKERLHLKKVLIVLDNVNDPIILKCLVGNRDWFGQGSRIIITTRDERLLIS

HMMPfam: PF00931
IPR002182
194-459 NB-ARC,NBS
NB-ARC

ARMQEIEMRLCLEFDDFLMVGIWGMGGIGKTTLARAIYRKIRGQFEACCFFENVEEDLANEGLIKLQQKFLAQLLEEPNLNMKALTSIKERLHLKKVLIVLDNVNDPIILKCLVGNRDWFGQGSRIIITTRDERLLISHGVLNCYEARRFNYDEAKRFLSHYLLKHEILRDDFIELSREVIGYAQGLPLALEVLGSFLFSMTKEEWRNQLDKLKSTPNMKIQEVLKVSYKGLDDKEKNIFLDIACFFKGEDKDYVMEILDGCGFFS

FPrintScan: PR00364
IPR000767
212-227 DISEASERSIST
Disease resistance protein

MVGIWGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
284-298 DISEASERSIST
Disease resistance protein

RLHLKKVLIVLDNVN

FPrintScan: PR00364
IPR000767
377-391 DISEASERSIST
Disease resistance protein

AQGLPLALEVLGSFL

Gene3D: G3DSA:3.40.50.300
382-418 no description

LALEVLGSFLFSMTKEEWRNQLDKLKSTPNMKIQEVL

superfamily: SSF52058
481-670 L domain-like,LRR

MMHDLIQEMGREIVRQQSLEEPSKRSRLWFHEDIYDVLQKNTATEKIEGIFLNLSHLEEMLDFTTQALARMNRLRLLKVLEKLKFMDLSHSKYLIETPNFQGVTNLKRLVLEDCVSLRKVHSSLGDLKNLSFLNLKNCKMLKSLPSSTCDLKSLETFILSGCSKFEGFPENFGSLEMLKELYADEIAIRG

Gene3D: G3DSA:3.80.10.10
518-679 no description

LQKNTATEKIEGIFLNLSHLEEMLDFTTQALARMNRLRLLKVLEKLKFMDLSHSKYLIETPNFQGVTNLKRLVLEDCVSLRKVHSSLGDLKNLSFLNLKNCKMLKSLPSSTCDLKSLETFILSGCSKFEGFPENFGSLEMLKELYADEIAIRGYFVASIASM

Seg: seg
553-564 seg

RLRLLKVLEKLK

FPrintScan: PR00364
IPR000767
558-574 DISEASERSIST
Disease resistance protein

KVLEKLKFMDLSHSKYL

Seg: seg
827-834 seg

PPPPPPPP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox