PRGDB00078910 (Vvi.18120)

From PRG Wiki
Jump to: navigation, search
Vvi.18120
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 225460150 (XM_002276039)
Gene Class CNL
Domain Type NBS, TIR, LRR, Others
Gene Species Vitis vinifera

Comment?

PREDICTED: Vitis vinifera hypothetical protein LOC100261954 (LOC100261954), mRNA

DNA Sequence

ATggcttctgctgctgcttcttcttcttcttctCAAACGCGCTATGATGTGTTCCTCAGCTTCAGAGGAGAAGACACCCGCAATAACTTCACTGCCCATCTCTATCACGCCTTGTGCCAGAAAGGAATCAACACTTTCATCGATGATGACAAGCTTGAGAGAGGCCAAGTCATATCTCCTGCCCTTGTTGCAGCTATCGAAAACTCCATGTTTTCAATAGTTGTTTTGTCGAAAAATTATGCATTCTCTAGATGGTGTTTACAGGAATTGGTGAAGATAGTAGAGTGCATGAAAAGCAGGAGACAGAGGGTTGTCCCAATTTTCTACAATGTCGATCCCTCGGATGTGAGAAGACAGAGGGGCATATTTGGAGAAGCATTGGCTAAACATGAAGAGAACTCGGAGAACATGGAGAGGGTGCAGAGTTGGAAGGATGCTCTCACTCAAGTTGCAAATTTATCCGGTTGGGATTCAAGAAATAAGAATGAGCCTCTACTAATCAAGGAAATCGTTACAGATATTTTGAATAAATTGTTAAGTACATCTATTAGTGATACTGAAAATCTGGTTGGAATAGATGCTCGCATGCAAGAAATAGAGATGCGATTATGTTTGGGGTCTGATGATTTTCTGATGGTAGGAATTTGGGGCATGGGCGGAATAGGGAAAACAACCCTTGCTAGAGCTATTTATAGAAAAATCACTTGTCAATTTGAAGCATGTTGTTTTTTTGAAAATGTTGGGGAGGATTTGGCAAAGGAGGGTTTAATAGGATTGCAACAAAAGTTTCTTGCTCAACTATTGGAGGAACCAAATCTAAATATGAAGGCACTCACATCTATAAAGGGAAGGCTCCACTCAAAGAAGGTCCTTATTGTTCTTGATAATGTGAATGATCCAATAATATTGAAATGCTTGGTTGGAAACTATGATTGGTTTGGTCGAGGAAGTAGAATTATTATAACCACTAGGGATAAGCGTTTGTTAATTTCACATGGAGTACTCAATTATTATGAGGCTCAGAGATTTAATTATGACGAAGCTTCTGAGTTCCTTACACCCTATTCATTAAAACATAAAATTCCTTGTGATGATTTCATGGAGGTTTCAAAAGAAGTAATTGGTTATGCTCAAGGCCTCCCATTGGCTCTAGAAGTTTTAGGTTCCTTTTTATTTAGCATGACCAAAGAAGAATGGAGAAATCAATTAGACAAACTGAAAATAAGTTATGATGGGCTAGATGATAAGGAGAAGAATATACTACTAGACATTGCATGTTTCTTTAAAGGAGAGGATAAAGATTATGTAATGGAAATACTAGATGGTTGCGGCTTTTTCTCACTTAGTGGAATACGAGCTCTCATTGATAAGTCACTCGTAACTATTTCTTGGAGTAATGAGATAATGATGCATGACTTAATACAAGAAATGGGTAGGGAAATTGTTCGTCAGCAATCCCTTGAAGAGCCTGGTAAACGTAGCAGATTATGGTTTCATGAAGATATCAATGGCGTTCTTGCAAATTTGAAATTCATGGATCTCAGTCACTCTAAGTACTTAATAGAAACTCCAAATTTTCGGGGAGTCACCAACCTCAAACGGTTAGTTTTGGAAGGATGTGTGTCTTTACGTAAGGTGCACTCATCACTTGGAGATTTGAAGAATCTCATTTTCTTGAATTTGAAAAACTGCCAAATGCTAAAGAGCCTTCCAAGTAGCACTTGTGATTTGAAGTCTCTTGAAACGTTTATTCTTTCTGGTTGCTCCAAATTTAAAGAATTTCCTGAGAACTTTGGGAGCTTAGAAATGTTGAAGGAACTTTATGCAGATGAAATTGCTATAGGAGTACTTCCCTCCTCTTTTTCTTTCTTAAGAAACCTTCAAATATTATCCTTTAAGGGATGTAAAGGACCATCATCTACGCTATGGTTGTTGCCAAGAAGAAGTTCAAATTCCATTGGTTCCATATTGCAACCTTTGTCAGGTTTACGCTCTTTAATAAGACTAAACCTCAGTAACTGCAATTTATCGGATGAACCAAACCTTAGCAGTCTTGGCTTCTTATCATCGTTGGAAGAGTTATATTTAGGTGGGAACGACTTTGTTACTTTGCCTTCAACCATCAGTCAACTTTCTAACCTAACGTTGTTGGGGTTGGAAAATTGTAAAAGACTACAAGTACTTCCAGAGCTTCCATCAAGCATATATTATATATGTGCAGAAAATTGCACATCATTAAAAGATGTCTCATATCAAGTACTTAAGTCACTACTTCCAACTGGCCAACACCAAAAGCGCAAGTTCATGGTTCCCGTTGTGAAACCGGATACAGCCTTAGCGGTTTTGGAAGCATCTAATCCTGGGATTAGAATACCACATAGGGCAAGTTATCAGAGGATCGATCCCGTTGTGAAACTGGGTATAGCCACAGTGGCTTTAAAAGCATTTATTCCTGGGAGTAGAATACCAGATTGGATAAGGTATCAGAGCTCAGGGAGTGAAGTAAAAGCAGAGCTACCTCCAAATTGGTTTAATTCCAACTTCCTGGGTTTTGCTTTTAGTTTTGTCACTTGTGGCCATTTCTCTTGCCTCTTCATGTTGAAAGCGGATGTCTTGTTTGATTGGACATCCAGGGACGATTCTTCCTCCGTTGATATCATTATTGTCGAAATGATTTCCTTTAAGAGAAGGTTGGAGACGGATCACGTGTGCCTGTGTTATGTACCACTTCCCCAGTTGCGGAATTGCTCTCAAGTGACTCACATCAAGGTATCATTTATGGCAGTCTCCAGGGAGGGTGAGATTGAAATTAAGAGGTGTGGGGTTGGTGTAGTGTACAGTAATGAAGATGGGAATCACAACAATCCCCCAATGATCCGATTCAACTCTATctcctctcctcctcctcctcctcGTAGTAAGTCAACCGTTGTCCTTGAAGAAATCCATGAGGAGGAACCTAGTGGAAATGGGTGCTCTAATGTTGATGGCTCAGAAGAAGTGAGGAGGAACCTAGAACTGCTACTGTCTGCTCTGAGGATCGGTCTGAATCAGATATTCGGCCACAGAAATGCTTGA


Protein sequences

Name Description Sequence
Vvi.18120 translated coding region predicted by ESTScan from UniGene Vvi.18120

MASAAASSSSSQTRYDVFLSFRGEDTRNNFTAHLYHALCQKGINTFIDDDKLERGQVISPALVAAIENSMFSIVVLSKNYAFSRWCLQELVKIVECMKSRRQRVVPIFYNVDPSDVRRQRGIFGEALAKHEENSENMERVQSWKDALTQVANLSGWDSRNKNEPLLIKEIVTDILNKLLSTSISDTENLVGIDARMQEIEMRLCLGSDDFLMVGIWGMGGIGKTTLARAIYRKITCQFEACCFFENVGEDLAKEGLIGLQQKFLAQLLEEPNLNMKALTSIKGRLHSKKVLIVLDNVNDPIILKCLVGNYDWFGRGSRIIITTRDKRLLISHGVLNYYEAQRFNYDEASEFLTPYSLKHKIPCDDFMEVSKEVIGYAQGLPLALEVLGSFLFSMTKEEWRNQLDKLKISYDGLDDKEKNILLDIACFFKGEDKDYVMEILDGCGFFSLSGIRALIDKSLVTISWSNEIMMHDLIQEMGREIVRQQSLEEPGKRSRLWFHEDINGVLANLKFMDLSHSKYLIETPNFRGVTNLKRLVLEGCVSLRKVHSSLGDLKNLIFLNLKNCQMLKSLPSSTCDLKSLETFILSGCSKFKEFPENFGSLEMLKELYADEIAIGVLPSSFSFLRNLQILSFKGCKGPSSTLWLLPRRSSNSIGSILQPLSGLRSLIRLNLSNCNLSDEPNLSSLGFLSSLEELYLGGNDFVTLPSTISQLSNLTLLGLENCKRLQVLPELPSSIYYICAENCTSLKDVSYQVLKSLLPTGQHQKRKFMVPVVKPDTALAVLEASNPGIRIPHRASYQRIDPVVKLGIATVALKAFIPGSRIPDWIRYQSSGSEVKAELPPNWFNSNFLGFAFSFVTCGHFSCLFMLKADVLFDWTSRDDSSSVDIIIVEMISFKRRLETDHVCLCYVPLPQLRNCSQVTHIKVSFMAVSREGEIEIKRCGVGVVYSNEDGNHNNPPMIRFNSISSPPPPPRSKSTVVLEEIHEEEPSGNGCSNVDGSEEVRRNLELLLSALRIGLNQIFGHRNA

Domains

Domain Start-End Description Sequence

Seg: seg
2-11 seg

ASAAASSSSS

superfamily: SSF52200
IPR000157
3-156 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

SAAASSSSSQTRYDVFLSFRGEDTRNNFTAHLYHALCQKGINTFIDDDKLERGQVISPALVAAIENSMFSIVVLSKNYAFSRWCLQELVKIVECMKSRRQRVVPIFYNVDPSDVRRQRGIFGEALAKHEENSENMERVQSWKDALTQVANLSGW

Gene3D: G3DSA:3.40.50.10140
10-147 no description

SSQTRYDVFLSFRGEDTRNNFTAHLYHALCQKGINTFIDDDKLERGQVISPALVAAIENSMFSIVVLSKNYAFSRWCLQELVKIVECMKSRRQRVVPIFYNVDPSDVRRQRGIFGEALAKHEENSENMERVQSWKDAL

ProfileScan: PS50104
IPR000157
13-153 TIR
Toll-Interleukin receptor

TRYDVFLSFRGEDTRNNFTAHLYHALCQKGINTFIDDDKLERGQVISPALVAAIENSMFSIVVLSKNYAFSRWCLQELVKIVECMKSRRQRVVPIFYNVDPSDVRRQRGIFGEALAKHEENSENMERVQSWKDALTQVANL

HMMSmart: SM00255
IPR000157
14-153 Toll
Toll/interleukin-1 receptor homology (TIR) domain

RYDVFLSFRGEDTRNNFTAHLYHALCQKGINTFIDDDKLERGQVISPALVAAIENSMFSIVVLSKNYAFSRWCLQELVKIVECMKSRRQRVVPIFYNVDPSDVRRQRGIFGEALAKHEENSENMERVQSWKDALTQVANL

HMMPfam: PF01582
IPR000157
17-148 TIR
Toll-Interleukin receptor

VFLSFRGEDTRNNFTAHLYHALCQKGINTFIDDDKLERGQVISPALVAAIENSMFSIVVLSKNYAFSRWCLQELVKIVECMKSRRQRVVPIFYNVDPSDVRRQRGIFGEALAKHEENSENMERVQSWKDALT

HMMPanther: PTHR11017:SF20
38-750 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LCQKGINTFIDDDKLERGQVISPALVAAIENSMFSIVVLSKNYAFSRWCLQELVKIVECMKSRRQRVVPIFYNVDPSDVRRQRGIFGEALAKHEENSENMERVQSWKDALTQVANLSGWDSRNKNEPLLIKEIVTDILNKLLSTSISDTENLVGIDARMQEIEMRLCLGSDDFLMVGIWGMGGIGKTTLARAIYRKITCQFEACCFFENVGEDLAKEGLIGLQQKFLAQLLEEPNLNMKALTSIKGRLHSKKVLIVLDNVNDPIILKCLVGNYDWFGRGSRIIITTRDKRLLISHGVLNYYEAQRFNYDEASEFLTPYSLKHKIPCDDFMEVSKEVIGYAQGLPLALEVLGSFLFSMTKEEWRNQLDKLKISYDGLDDKEKNILLDIACFFKGEDKDYVMEILDGCGFFSLSGIRALIDKSLVTISWSNEIMMHDLIQEMGREIVRQQSLEEPGKRSRLWFHEDINGVLANLKFMDLSHSKYLIETPNFRGVTNLKRLVLEGCVSLRKVHSSLGDLKNLIFLNLKNCQMLKSLPSSTCDLKSLETFILSGCSKFKEFPENFGSLEMLKELYADEIAIGVLPSSFSFLRNLQILSFKGCKGPSSTLWLLPRRSSNSIGSILQPLSGLRSLIRLNLSNCNLSDEPNLSSLGFLSSLEELYLGGNDFVTLPSTISQLSNLTLLGLENCKRLQVLPELPSSIYYICAENCTSLKDVS

HMMPanther: PTHR11017
38-750 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LCQKGINTFIDDDKLERGQVISPALVAAIENSMFSIVVLSKNYAFSRWCLQELVKIVECMKSRRQRVVPIFYNVDPSDVRRQRGIFGEALAKHEENSENMERVQSWKDALTQVANLSGWDSRNKNEPLLIKEIVTDILNKLLSTSISDTENLVGIDARMQEIEMRLCLGSDDFLMVGIWGMGGIGKTTLARAIYRKITCQFEACCFFENVGEDLAKEGLIGLQQKFLAQLLEEPNLNMKALTSIKGRLHSKKVLIVLDNVNDPIILKCLVGNYDWFGRGSRIIITTRDKRLLISHGVLNYYEAQRFNYDEASEFLTPYSLKHKIPCDDFMEVSKEVIGYAQGLPLALEVLGSFLFSMTKEEWRNQLDKLKISYDGLDDKEKNILLDIACFFKGEDKDYVMEILDGCGFFSLSGIRALIDKSLVTISWSNEIMMHDLIQEMGREIVRQQSLEEPGKRSRLWFHEDINGVLANLKFMDLSHSKYLIETPNFRGVTNLKRLVLEGCVSLRKVHSSLGDLKNLIFLNLKNCQMLKSLPSSTCDLKSLETFILSGCSKFKEFPENFGSLEMLKELYADEIAIGVLPSSFSFLRNLQILSFKGCKGPSSTLWLLPRRSSNSIGSILQPLSGLRSLIRLNLSNCNLSDEPNLSSLGFLSSLEELYLGGNDFVTLPSTISQLSNLTLLGLENCKRLQVLPELPSSIYYICAENCTSLKDVS

superfamily: SSF52540
172-406 P-loop containing nucleoside triphosphate hydrolases

TDILNKLLSTSISDTENLVGIDARMQEIEMRLCLGSDDFLMVGIWGMGGIGKTTLARAIYRKITCQFEACCFFENVGEDLAKEGLIGLQQKFLAQLLEEPNLNMKALTSIKGRLHSKKVLIVLDNVNDPIILKCLVGNYDWFGRGSRIIITTRDKRLLISHGVLNYYEAQRFNYDEASEFLTPYSLKHKIPCDDFMEVSKEVIGYAQGLPLALEVLGSFLFSMTKEEWRNQLDKL

Gene3D: G3DSA:3.40.50.300
185-337 no description

DTENLVGIDARMQEIEMRLCLGSDDFLMVGIWGMGGIGKTTLARAIYRKITCQFEACCFFENVGEDLAKEGLIGLQQKFLAQLLEEPNLNMKALTSIKGRLHSKKVLIVLDNVNDPIILKCLVGNYDWFGRGSRIIITTRDKRLLISHGVLNY

HMMPfam: PF00931
IPR002182
194-444 NB-ARC,NBS
NB-ARC

ARMQEIEMRLCLGSDDFLMVGIWGMGGIGKTTLARAIYRKITCQFEACCFFENVGEDLAKEGLIGLQQKFLAQLLEEPNLNMKALTSIKGRLHSKKVLIVLDNVNDPIILKCLVGNYDWFGRGSRIIITTRDKRLLISHGVLNYYEAQRFNYDEASEFLTPYSLKHKIPCDDFMEVSKEVIGYAQGLPLALEVLGSFLFSMTKEEWRNQLDKLKISYDGLDDKEKNILLDIACFFKGEDKDYVMEILDGCG

FPrintScan: PR00364
IPR000767
212-227 DISEASERSIST
Disease resistance protein

MVGIWGMGGIGKTTLA

FPrintScan: PR00364
IPR000767
284-298 DISEASERSIST
Disease resistance protein

RLHSKKVLIVLDNVN

FPrintScan: PR00364
IPR000767
377-391 DISEASERSIST
Disease resistance protein

AQGLPLALEVLGSFL

Coil: coil
396-417 coiled-coil

KEEWRNQLDKLKISYDGLDDKE

superfamily: SSF52058
469-744 L domain-like,LRR

MMHDLIQEMGREIVRQQSLEEPGKRSRLWFHEDINGVLANLKFMDLSHSKYLIETPNFRGVTNLKRLVLEGCVSLRKVHSSLGDLKNLIFLNLKNCQMLKSLPSSTCDLKSLETFILSGCSKFKEFPENFGSLEMLKELYADEIAIGVLPSSFSFLRNLQILSFKGCKGPSSTLWLLPRRSSNSIGSILQPLSGLRSLIRLNLSNCNLSDEPNLSSLGFLSSLEELYLGGNDFVTLPSTISQLSNLTLLGLENCKRLQVLPELPSSIYYICAENCT

FPrintScan: PR00364
IPR000767
504-520 DISEASERSIST
Disease resistance protein

GVLANLKFMDLSHSKYL

Gene3D: G3DSA:3.80.10.10
505-732 no description

VLANLKFMDLSHSKYLIETPNFRGVTNLKRLVLEGCVSLRKVHSSLGDLKNLIFLNLKNCQMLKSLPSSTCDLKSLETFILSGCSKFKEFPENFGSLEMLKELYADEIAIGVLPSSFSFLRNLQILSFKGCKGPSSTLWLLPRRSSNSIGSILQPLSGLRSLIRLNLSNCNLSDEPNLSSLGFLSSLEELYLGGNDFVTLPSTISQLSNLTLLGLENCKRLQVLPELP

HMMSmart: SM00369
IPR003591
553-577 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKNLIFLNLKNCQMLKSLPSSTCDL

ProfileScan: PS51450
IPR001611
555-577 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLIFLNLKNCQMLKSLPSSTCDL

HMMSmart: SM00369
IPR003591
663-686 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LRSLIRLNLSNCNLSDEPNLSSLG

ProfileScan: PS51450
IPR001611
665-686 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLIRLNLSNCNLSDEPNLSSLG

Seg: seg
682-698 seg

LSSLGFLSSLEELYLGG

HMMSmart: SM00369
IPR003591
688-711 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSSLEELYLGGNDFVTLPSTISQL

ProfileScan: PS51450
IPR001611
690-711 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEELYLGGNDFVTLPSTISQL

HMMPfam: PF00560
IPR001611
690-711 LRR_1
Leucine-rich repeat

SLEELYLGGNDFVTLPSTISQL

Seg: seg
879-889 seg

DDSSSVDIIIV

Seg: seg
963-975 seg

SISSPPPPPRSKS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox