PRGDB00078969 (Vvi.20701)

From PRG Wiki
Jump to: navigation, search
Vvi.20701
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 225464429 (XM_002264363)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Vitis vinifera

Comment?

PREDICTED: Vitis vinifera hypothetical protein LOC100266302 (LOC100266302), mRNA

DNA Sequence

GGTACAAGCCATCTAGTAATGGCTTCTGCGGACCGAAATTACGATGTATTCTTGAGTTTTAGAGGTGAAGACACCCGCAAAAATTTCAGTGATCATCTCTACACCACTTTGATTGCAAATGGAATTCATACTTTCAGAGACAGTGAAGAACTTGATAAAGGAGGAGATATTGCATCTGAACTCTCAAGAGTAATTCAGAAATCAAGGATTTTCATTATCATATTCTCAAGAAATTATGCTACTTCGAAATGGTGTTTAAATGAACTTGTAAAAATCACTGAGCGTATGACACAGAAAGAGTCAACAATCCATCCTGTTTTCTACCATGTGAATCCATCAGAAGTGCGACATCAATCCGGAAGTTATGGAGAGGCCTTTTCCAACTATGAAAAGGATGCAGACCTAGAGAAGGAGAACATAGTGAAGTGGAGGGCTGCCTTGACACAAGTAGGCAATCTATCCGGATGGCATGTGGATAACCAATATGAGTCAGAGGTACTCATAGGAATCACTAATGACATCATCAGAAGATTAAATCGTGAGCCTTTAAATGTGGGCAAGAACATAATCGGAATGAGTTTTCATTTGGAAAAACTCAAATCATTGATGAACATTGAGTCAAATGAGGTTTGTGTGGTTGGGATATCTGGAATCGGTGGAATTGGTAAAACTACTATTGCTAAAGCTATTTATAATGATATCTCATATGAATTCCATGGTAGTTGCTTTCTTAAAAATGTTAGAGAGAGATCTAAAGATAATACACTTCAATTGCAACAAGAACTTCTTCATGGTATCCTAAGGGGAAAATGTTTGAAAGTAAGCAATATTGAAGAAGGACTCAAGATGATAAAAAATTGTCTTAACTCAAAAAAGGTTCTTGTTGTCCTTGATGATGTGGACGCTCTAAAGCAATTGGAATACTTGGCTGAAGAGCCTGAGTGGTTTAGTACAAAAAGCATTGTCATCATAACCACTAGAGATAAACGTTTCCTCACTCAATATGGGAAGCATGTATCATATGAGGTTGAGAAACTAAATGAAGAAGAATCTATTGAGCTCTTTAGTAGGTGGGCATTTAAACAGAATCTGCCTCAAGAAGCTTATAGAAACCTCTCCTACCACATAATAGAATATGCTAAAGGCCTTCCATTAGCACTCAAAGTTTTGGGCTCCTTTTTTCTTGGAAAGACAAGATCTCAATGGAAAGAAGCATTGCATAAGCTAGAAAAGATACCTCACATAGAGATTCAAAATGTACTTAAAATAAGCTATGATGGACTCAATGATATAGAGAAAGGAATATTCCTTGATATTGCATGTTTTTTCGAAGGGGAAGATAAAGAAGTTGTTTCAAGAATATTACATAATGTCTCTATAGAGTGTGGAATAAGTATTCTTCATGATAAGGGTTTGATAACTATTTTAGAAAATAAGTTAGAGATGCATAATTTGATACAACAAATGGGTCATGAAATTGTTCGCCAAGAATGTCCGAAAGAGCCTGGAAAATGGAGCAGATTGTGGGATCCTGAAGATGTTTATCGAGTACTAACCAAAAATACGGGGACAGAAGCTATTGAAGGAATAATCCTAGACATATCTGCATCAGAACAGATACAATTCACTACAGAAGCTTTTAAAATGATGAACAGACTTAGATTGCTCATAGTACATCAAGATGCAAAATACGATTCTATGGTAGAACATCATGTTGTGGGGGATCAAGTGCAACTCTCTAAGATGCACCTTCCTGCAAACTTTCAAATTCCTTCTTTTGAGTTAACATTTCTCCATTGGGATGGATACTCCTTGGAATCTTTGCCCTCAAATTTTCAAGCAGATAATCTTGTTGAACTCCATTTACGGTGTAGCAACATAAAACAACTTTGTGAAGGAAATATGATATTTAACATATTAAAGGTCATCAATCTCAGTTTTTCTGTGCATCTCATCAAAATCCCAGACATCACAAGTGTGCCGAATTTGGAGATTCTAATTCTAGAAGGTTGTACAAACCTCATGAGTCTTCCGAGTGACATTTACAAGTTGAAAGGCCTTCGTACTCTGTGTTGCCGTGAATGTTTAAAGCTAAGGAGTTTCCCAGAAATCAAGGAAAGAATGAAAAATCTAAGGGAGCTTTATCTAAGCGAGACAGATTTAAAAGAGTTACCATCATCCTCAACAAAACATCTTAAGGGCCTTACAGACTTGGATTTGACAGGATGCAGAAACCTTATACATGTTCCAAAGAGCATTTGTGCAATGAGGTCTCTTAAAGCTCTCAGTTTTAGTTACTGTCCAAAACTGGACAAATTGCCGGAGGACTTGGAGAGCCTGCCTTGCTTAGAGAGTCTTTCATTGAATTTCCTTAGATGTGAACTGCCTTGTTTGTCAGGTTTATCCTCCTTAAAAGAATTATCTCTAGACCAATCCAATATAACTGGTGAAGTAATCCCGAATGACAATGGCTTGTCCTCATTGAAGTCCTTAAGTCTTAACTACAATAGAATGGAACGGGGGATACTCAGTAACATTTTCTGCCTCTCTTCATTGGAAGAATTAAAACTCAGGGGGAACCATTTTAGTACAATACCTGCTGGCATAAGTAAACTTCCAAGATTGAGATCTCTTAACTTGAGCCACTGCAAGAAGCTTCTACAAATTCCAGAGCTTCCTTCAAGTCTGCGAGCTTTAGATACACATGGTTCACCAGTTACTTTATCATCAGGTCCGTGGAGTCTCCTCAAATGCTTCAAGTCGGCAATTCAGGAGACAGATTGTAATTTCACAAAAGTTGTGTTCATTCCTGGAGATAGTGGGATTCCAAAGTGGATAAATGGTTTCCAAAAGGGAAGTTATGCAGAAAGAATGCTTCCTCAGAATTGGTACCAAGATAACATGTTCTTGGGATTTTCCATAGGCTGTGCCTATGTTCTGCTTGATAATGAATCTGACCGTGAATTTGACTACAGCTCTGAAAATGAATCTGAGCATACGTCCTCAGACGAATCTGATTACAGCTCCGAGAATGAAGAATCTCAGAAAAAATCTGCTCATACATCTCATAATTTAGAATGTCATTTGATTATGGAAGGTGAAGGTGATGATCTTAGAGACTTGGAGCATTTCCCATTTCCTTTTGATTGTGAGTGCTATGAAGATGATGAGGATGGGGTATCAGATCAGATGTGGGTAATGTATTATCCTAAGGTAGCTATTCCTGAAAATTTTCACTCTAACCAATGGACGGCACTTCAGGCTTCAATAGAGGGCTATAACCGCTATGGTAAACCCTTGAAAGTAAAATACTGTGTCATTGATCTTATATATGACCTAGCTCATCAAAACAGGGACCTGGCTGGGACATTTAGAGATCACGGATATAGCTGCTCAGATTGTCAATTGGATACGGAATGTGAATTGAAGCTTTGTTTAGCGGGCAATGAATTCTATGAACTGCCCACTATTGAGTGTCCCTTAGCACTTGATAGTTTGTGTTTGCGCAACTGCGAAAAGCTTGAGAGTCTTCCAAGTGACATTTGTAAGTTGAAATCCCTTAAAAGTCTCTTTTGCTCTGGCTGTTCGGAACTAAAGAGCTTTCCGGAAATCGTGGAGAATATGGAAAATTTAAGAAAGCTTTATTTAAACCAAACAGCTATAGAAGAGCTACCATCCTCAATTGATCATCTACAAGGGCTTCAGTGTCTGAGTGTGGAAAGTTGCGACAACCTTGTGAGTCTTCCAGAGAGCATTTGTAATTTGACATCTCTTAAAGTTCTTGTGGTTGATTGTTGTCCAAAGCTCTACAAGTTGCCAGAGAACTTGGGGAGCCTCCGAAGTTTAGAAGAGCTTTATGCTACACATTCATATTCAATTGGCTGTCAGTTGCCTTCTTTATCAGGTTTATGTTCCTTGAGAATATTAGATATACAAAATTCAAATCTATCACAAAGAGCAATCCCGAATGACATTTGCTGCCTCTACTCATTGAAACTATTAAATCTTAGCAACTTCAATCTAATTGAAGGAGGAATCCCCAGAGAAATTTACAACCTATCATCACTTCAAGCATTACTTCTAGGGGGGAACCATTTTAGTAGTATACCTGATGGCATCAGTAGACTTACAGCACTGAGAGTTCTTGACTTGAGCCACTGTCAAAACCTACTAAGAATTCCAGAGTTCTCATCAAGTCTGCAAGTTTTAGATGTACACAGCTGCACATCCCTGGAAACTTTATCAAGTCCATCAAATCTTCTTCAATCTTGTCTGTTAAAATGCTTCAAATCATTAATTCAGGATTTGGAACTTGAGAATGATATTCCAATAGAACCCCATGTTGCTCCCTATTTGAATGGTGGAATTAGCATTGCCATTCCTAGAAGTAGTGGAATTCCAGAGTGGATAAGGTATCAGAAAGAGGGATCCAAAGTTGCAAAAAAGCTTCCACGGAACTGGTACAAAAATGATGACTTCTTAGGATTTGCTTTATTCTCCATTCACGTTCCACTTGATTATGAATCTGATGACTTATTTGATAACCAAGACACTTGGAGTTCAGAATCTGATATTGAATATGAGGATGAAATTGATAACCAAGAAACTCCAAGCTCAGAACCTGACAATGAATCTGAGGATGGCCTTGATAATGAAAATACTTGGAGTTTAGAATGTGAATTAACTATAGGTGATGATCATCGATTCTGGTTCAAGGATCATGTATCGTTTCAATGCTGCTGTAAATGTGACATTGATGATGATGTACCAAATCAAGTGTGGGTGACCTATTATCCTAAGATTATTATTCCAATGAAGTATGCCTCCAACAAAAGGAGGCGCTTGAAGGCTTCATTTCAGGGTTTCTTTTGTGGTGAACCAGTGGAAGTGGAAAAGTGTGGGATCCAGCTTATATATGCCCGAGATGATGAGCAGAAGATCATATCCAGGCAAGATGATGCTAAGAGGAGCTGTGACGATGTAGAAGACAACCCAGCTGATGAGCCCCACCATAAAAGGTTCAAACAGCCCCAACACTGA


Protein sequences

Name Description Sequence
Vvi.20701 translated coding region predicted by ESTScan from UniGene Vvi.20701

GTSHLVMASADRNYDVFLSFRGEDTRKNFSDHLYTTLIANGIHTFRDSEELDKGGDIASELSRVIQKSRIFIIIFSRNYATSKWCLNELVKITERMTQKESTIHPVFYHVNPSEVRHQSGSYGEAFSNYEKDADLEKENIVKWRAALTQVGNLSGWHVDNQYESEVLIGITNDIIRRLNREPLNVGKNIIGMSFHLEKLKSLMNIESNEVCVVGISGIGGIGKTTIAKAIYNDISYEFHGSCFLKNVRERSKDNTLQLQQELLHGILRGKCLKVSNIEEGLKMIKNCLNSKKVLVVLDDVDALKQLEYLAEEPEWFSTKSIVIITTRDKRFLTQYGKHVSYEVEKLNEEESIELFSRWAFKQNLPQEAYRNLSYHIIEYAKGLPLALKVLGSFFLGKTRSQWKEALHKLEKIPHIEIQNVLKISYDGLNDIEKGIFLDIACFFEGEDKEVVSRILHNVSIECGISILHDKGLITILENKLEMHNLIQQMGHEIVRQECPKEPGKWSRLWDPEDVYRVLTKNTGTEAIEGIILDISASEQIQFTTEAFKMMNRLRLLIVHQDAKYDSMVEHHVVGDQVQLSKMHLPANFQIPSFELTFLHWDGYSLESLPSNFQADNLVELHLRCSNIKQLCEGNMIFNILKVINLSFSVHLIKIPDITSVPNLEILILEGCTNLMSLPSDIYKLKGLRTLCCRECLKLRSFPEIKERMKNLRELYLSETDLKELPSSSTKHLKGLTDLDLTGCRNLIHVPKSICAMRSLKALSFSYCPKLDKLPEDLESLPCLESLSLNFLRCELPCLSGLSSLKELSLDQSNITGEVIPNDNGLSSLKSLSLNYNRMERGILSNIFCLSSLEELKLRGNHFSTIPAGISKLPRLRSLNLSHCKKLLQIPELPSSLRALDTHGSPVTLSSGPWSLLKCFKSAIQETDCNFTKVVFIPGDSGIPKWINGFQKGSYAERMLPQNWYQDNMFLGFSIGCAYVLLDNESDREFDYSSENESEHTSSDESDYSSENEESQKKSAHTSHNLECHLIMEGEGDDLRDLEHFPFPFDCECYEDDEDGVSDQMWVMYYPKVAIPENFHSNQWTALQASIEGYNRYGKPLKVKYCVIDLIYDLAHQNRDLAGTFRDHGYSCSDCQLDTECELKLCLAGNEFYELPTIECPLALDSLCLRNCEKLESLPSDICKLKSLKSLFCSGCSELKSFPEIVENMENLRKLYLNQTAIEELPSSIDHLQGLQCLSVESCDNLVSLPESICNLTSLKVLVVDCCPKLYKLPENLGSLRSLEELYATHSYSIGCQLPSLSGLCSLRILDIQNSNLSQRAIPNDICCLYSLKLLNLSNFNLIEGGIPREIYNLSSLQALLLGGNHFSSIPDGISRLTALRVLDLSHCQNLLRIPEFSSSLQVLDVHSCTSLETLSSPSNLLQSCLLKCFKSLIQDLELENDIPIEPHVAPYLNGGISIAIPRSSGIPEWIRYQKEGSKVAKKLPRNWYKNDDFLGFALFSIHVPLDYESDDLFDNQDTWSSESDIEYEDEIDNQETPSSEPDNESEDGLDNENTWSLECELTIGDDHRFWFKDHVSFQCCCKCDIDDDVPNQVWVTYYPKIIIPMKYASNKRRRLKASFQGFFCGEPVEVEKCGIQLIYARDDEQKIISRQDDAKRSCDDVEDNPADEPHHKRFKQPQH

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
2-156 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

TSHLVMASADRNYDVFLSFRGEDTRKNFSDHLYTTLIANGIHTFRDSEELDKGGDIASELSRVIQKSRIFIIIFSRNYATSKWCLNELVKITERMTQKESTIHPVFYHVNPSEVRHQSGSYGEAFSNYEKDADLEKENIVKWRAALTQVGNLSGW

Gene3D: G3DSA:3.40.50.10140
11-131 no description

DRNYDVFLSFRGEDTRKNFSDHLYTTLIANGIHTFRDSEELDKGGDIASELSRVIQKSRIFIIIFSRNYATSKWCLNELVKITERMTQKESTIHPVFYHVNPSEVRHQSGSYGEAFSNYEK

ProfileScan: PS50104
IPR000157
12-153 TIR
Toll-Interleukin receptor

RNYDVFLSFRGEDTRKNFSDHLYTTLIANGIHTFRDSEELDKGGDIASELSRVIQKSRIFIIIFSRNYATSKWCLNELVKITERMTQKESTIHPVFYHVNPSEVRHQSGSYGEAFSNYEKDADLEKENIVKWRAALTQVGNL

HMMSmart: SM00255
IPR000157
13-153 Toll
Toll/interleukin-1 receptor homology (TIR) domain

NYDVFLSFRGEDTRKNFSDHLYTTLIANGIHTFRDSEELDKGGDIASELSRVIQKSRIFIIIFSRNYATSKWCLNELVKITERMTQKESTIHPVFYHVNPSEVRHQSGSYGEAFSNYEKDADLEKENIVKWRAALTQVGNL

HMMPfam: PF01582
IPR000157
16-148 TIR
Toll-Interleukin receptor

VFLSFRGEDTRKNFSDHLYTTLIANGIHTFRDSEELDKGGDIASELSRVIQKSRIFIIIFSRNYATSKWCLNELVKITERMTQKESTIHPVFYHVNPSEVRHQSGSYGEAFSNYEKDADLEKENIVKWRAALT

HMMPanther: PTHR11017:SF20
38-1419 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

IANGIHTFRDSEELDKGGDIASELSRVIQKSRIFIIIFSRNYATSKWCLNELVKITERMTQKESTIHPVFYHVNPSEVRHQSGSYGEAFSNYEKDADLEKENIVKWRAALTQVGNLSGWHVDNQYESEVLIGITNDIIRRLNREPLNVGKNIIGMSFHLEKLKSLMNIESNEVCVVGISGIGGIGKTTIAKAIYNDISYEFHGSCFLKNVRERSKDNTLQLQQELLHGILRGKCLKVSNIEEGLKMIKNCLNSKKVLVVLDDVDALKQLEYLAEEPEWFSTKSIVIITTRDKRFLTQYGKHVSYEVEKLNEEESIELFSRWAFKQNLPQEAYRNLSYHIIEYAKGLPLALKVLGSFFLGKTRSQWKEALHKLEKIPHIEIQNVLKISYDGLNDIEKGIFLDIACFFEGEDKEVVSRILHNVSIECGISILHDKGLITILENKLEMHNLIQQMGHEIVRQECPKEPGKWSRLWDPEDVYRVLTKNTGTEAIEGIILDISASEQIQFTTEAFKMMNRLRLLIVHQDAKYDSMVEHHVVGDQVQLSKMHLPANFQIPSFELTFLHWDGYSLESLPSNFQADNLVELHLRCSNIKQLCEGNMIFNILKVINLSFSVHLIKIPDITSVPNLEILILEGCTNLMSLPSDIYKLKGLRTLCCRECLKLRSFPEIKERMKNLRELYLSETDLKELPSSSTKHLKGLTDLDLTGCRNLIHVPKSICAMRSLKALSFSYCPKLDKLPEDLESLPCLESLSLNFLRCELPCLSGLSSLKELSLDQSNITGEVIPNDNGLSSLKSLSLNYNRMERGILSNIFCLSSLEELKLRGNHFSTIPAGISKLPRLRSLNLSHCKKLLQIPELPSSLRALDTHGSPVTLSSGPWSLLKCFKSAIQETDCNFTKVVFIPGDSGIPKWINGFQKGSYAERMLPQNWYQDNMFLGFSIGCAYVLLDNESDREFDYSSENESEHTSSDESDYSSENEESQKKSAHTSHNLECHLIMEGEGDDLRDLEHFPFPFDCECYEDDEDGVSDQMWVMYYPKVAIPENFHSNQWTALQASIEGYNRYGKPLKVKYCVIDLIYDLAHQNRDLAGTFRDHGYSCSDCQLDTECELKLCLAGNEFYELPTIECPLALDSLCLRNCEKLESLPSDICKLKSLKSLFCSGCSELKSFPEIVENMENLRKLYLNQTAIEELPSSIDHLQGLQCLSVESCDNLVSLPESICNLTSLKVLVVDCCPKLYKLPENLGSLRSLEELYATHSYSIGCQLPSLSGLCSLRILDIQNSNLSQRAIPNDICCLYSLKLLNLSNFNLIEGGIPREIYNLSSLQALLLGGNHFSSIPDGISRLTALRVLDLSHCQNLLRIPEFSSSLQVLDVHSCTSLETLSSPSN

HMMPanther: PTHR11017
38-1419 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IANGIHTFRDSEELDKGGDIASELSRVIQKSRIFIIIFSRNYATSKWCLNELVKITERMTQKESTIHPVFYHVNPSEVRHQSGSYGEAFSNYEKDADLEKENIVKWRAALTQVGNLSGWHVDNQYESEVLIGITNDIIRRLNREPLNVGKNIIGMSFHLEKLKSLMNIESNEVCVVGISGIGGIGKTTIAKAIYNDISYEFHGSCFLKNVRERSKDNTLQLQQELLHGILRGKCLKVSNIEEGLKMIKNCLNSKKVLVVLDDVDALKQLEYLAEEPEWFSTKSIVIITTRDKRFLTQYGKHVSYEVEKLNEEESIELFSRWAFKQNLPQEAYRNLSYHIIEYAKGLPLALKVLGSFFLGKTRSQWKEALHKLEKIPHIEIQNVLKISYDGLNDIEKGIFLDIACFFEGEDKEVVSRILHNVSIECGISILHDKGLITILENKLEMHNLIQQMGHEIVRQECPKEPGKWSRLWDPEDVYRVLTKNTGTEAIEGIILDISASEQIQFTTEAFKMMNRLRLLIVHQDAKYDSMVEHHVVGDQVQLSKMHLPANFQIPSFELTFLHWDGYSLESLPSNFQADNLVELHLRCSNIKQLCEGNMIFNILKVINLSFSVHLIKIPDITSVPNLEILILEGCTNLMSLPSDIYKLKGLRTLCCRECLKLRSFPEIKERMKNLRELYLSETDLKELPSSSTKHLKGLTDLDLTGCRNLIHVPKSICAMRSLKALSFSYCPKLDKLPEDLESLPCLESLSLNFLRCELPCLSGLSSLKELSLDQSNITGEVIPNDNGLSSLKSLSLNYNRMERGILSNIFCLSSLEELKLRGNHFSTIPAGISKLPRLRSLNLSHCKKLLQIPELPSSLRALDTHGSPVTLSSGPWSLLKCFKSAIQETDCNFTKVVFIPGDSGIPKWINGFQKGSYAERMLPQNWYQDNMFLGFSIGCAYVLLDNESDREFDYSSENESEHTSSDESDYSSENEESQKKSAHTSHNLECHLIMEGEGDDLRDLEHFPFPFDCECYEDDEDGVSDQMWVMYYPKVAIPENFHSNQWTALQASIEGYNRYGKPLKVKYCVIDLIYDLAHQNRDLAGTFRDHGYSCSDCQLDTECELKLCLAGNEFYELPTIECPLALDSLCLRNCEKLESLPSDICKLKSLKSLFCSGCSELKSFPEIVENMENLRKLYLNQTAIEELPSSIDHLQGLQCLSVESCDNLVSLPESICNLTSLKVLVVDCCPKLYKLPENLGSLRSLEELYATHSYSIGCQLPSLSGLCSLRILDIQNSNLSQRAIPNDICCLYSLKLLNLSNFNLIEGGIPREIYNLSSLQALLLGGNHFSSIPDGISRLTALRVLDLSHCQNLLRIPEFSSSLQVLDVHSCTSLETLSSPSN

superfamily: SSF52540
172-417 P-loop containing nucleoside triphosphate hydrolases

NDIIRRLNREPLNVGKNIIGMSFHLEKLKSLMNIESNEVCVVGISGIGGIGKTTIAKAIYNDISYEFHGSCFLKNVRERSKDNTLQLQQELLHGILRGKCLKVSNIEEGLKMIKNCLNSKKVLVVLDDVDALKQLEYLAEEPEWFSTKSIVIITTRDKRFLTQYGKHVSYEVEKLNEEESIELFSRWAFKQNLPQEAYRNLSYHIIEYAKGLPLALKVLGSFFLGKTRSQWKEALHKLEKIPHIEI

Gene3D: G3DSA:3.40.50.300
186-333 no description

GKNIIGMSFHLEKLKSLMNIESNEVCVVGISGIGGIGKTTIAKAIYNDISYEFHGSCFLKNVRERSKDNTLQLQQELLHGILRGKCLKVSNIEEGLKMIKNCLNSKKVLVVLDDVDALKQLEYLAEEPEWFSTKSIVIITTRDKRFLT

HMMPfam: PF00931
IPR002182
198-450 NB-ARC,NBS
NB-ARC

KLKSLMNIESNEVCVVGISGIGGIGKTTIAKAIYNDISYEFHGSCFLKNVRERSKDNTLQLQQELLHGILRGKCLKVSNIEEGLKMIKNCLNSKKVLVVLDDVDALKQLEYLAEEPEWFSTKSIVIITTRDKRFLTQYGKHVSYEVEKLNEEESIELFSRWAFKQNLPQEAYRNLSYHIIEYAKGLPLALKVLGSFFLGKTRSQWKEALHKLEKIPHIEIQNVLKISYDGLNDIEKGIFLDIACFFEGEDKEV

FPrintScan: PR00364
IPR000767
212-227 DISEASERSIST
Disease resistance protein

VVGISGIGGIGKTTIA

Seg: seg
214-230 seg

GISGIGGIGKTTIAKAI

FPrintScan: PR00364
IPR000767
287-301 DISEASERSIST
Disease resistance protein

CLNSKKVLVVLDDVD

Seg: seg
291-304 seg

KKVLVVLDDVDALK

FPrintScan: PR00364
IPR000767
380-394 DISEASERSIST
Disease resistance protein

AKGLPLALKVLGSFF

superfamily: SSF52058
493-923 L domain-like,LRR

IVRQECPKEPGKWSRLWDPEDVYRVLTKNTGTEAIEGIILDISASEQIQFTTEAFKMMNRLRLLIVHQDAKYDSMVEHHVVGDQVQLSKMHLPANFQIPSFELTFLHWDGYSLESLPSNFQADNLVELHLRCSNIKQLCEGNMIFNILKVINLSFSVHLIKIPDITSVPNLEILILEGCTNLMSLPSDIYKLKGLRTLCCRECLKLRSFPEIKERMKNLRELYLSETDLKELPSSSTKHLKGLTDLDLTGCRNLIHVPKSICAMRSLKALSFSYCPKLDKLPEDLESLPCLESLSLNFLRCELPCLSGLSSLKELSLDQSNITGEVIPNDNGLSSLKSLSLNYNRMERGILSNIFCLSSLEELKLRGNHFSTIPAGISKLPRLRSLNLSHCKKLLQIPELPSSLRALDTHGSPVTLSSGPWSLLKCFKSAI

Gene3D: G3DSA:3.80.10.10
584-919 no description

LPANFQIPSFELTFLHWDGYSLESLPSNFQADNLVELHLRCSNIKQLCEGNMIFNILKVINLSFSVHLIKIPDITSVPNLEILILEGCTNLMSLPSDIYKLKGLRTLCCRECLKLRSFPEIKERMKNLRELYLSETDLKELPSSSTKHLKGLTDLDLTGCRNLIHVPKSICAMRSLKALSFSYCPKLDKLPEDLESLPCLESLSLNFLRCELPCLSGLSSLKELSLDQSNITGEVIPNDNGLSSLKSLSLNYNRMERGILSNIFCLSSLEELKLRGNHFSTIPAGISKLPRLRSLNLSHCKKLLQIPELPSSLRALDTHGSPVTLSSGPWSLLKCF

HMMSmart: SM00369
IPR003591
660-684 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

VPNLEILILEGCTNLMSLPSDIYKL

HMMSmart: SM00369
IPR003591
708-731 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MKNLRELYLSETDLKELPSSSTKH

HMMPfam: PF13855
710-767 LRR_8,Leucine rich repeat

NLRELYLSETDLKELPSSSTKHLKGLTDLDLTGCRNLIHVPKSICAMRSLKALSFSYC

Seg: seg
773-788 seg

LPEDLESLPCLESLSL

Seg: seg
798-809 seg

LSGLSSLKELSL

Seg: seg
825-833 seg

LSSLKSLSL

HMMSmart: SM00369
IPR003591
825-845 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSSLKSLSLNYNRMERGILSN

HMMSmart: SM00369
IPR003591
849-872 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSSLEELKLRGNHFSTIPAGISKL

HMMPfam: PF12799
851-892 LRR_4,Leucine Rich repeats (2 copies)

SLEELKLRGNHFSTIPAGISKLPRLRSLNLSHCKKLLQIPEL

FPrintScan: PR00364
IPR000767
870-886 DISEASERSIST
Disease resistance protein

SKLPRLRSLNLSHCKKL

Seg: seg
991-1014 seg

YSSENESEHTSSDESDYSSENEES

superfamily: SSF52058
1143-1415 L domain-like,LRR

KLCLAGNEFYELPTIECPLALDSLCLRNCEKLESLPSDICKLKSLKSLFCSGCSELKSFPEIVENMENLRKLYLNQTAIEELPSSIDHLQGLQCLSVESCDNLVSLPESICNLTSLKVLVVDCCPKLYKLPENLGSLRSLEELYATHSYSIGCQLPSLSGLCSLRILDIQNSNLSQRAIPNDICCLYSLKLLNLSNFNLIEGGIPREIYNLSSLQALLLGGNHFSSIPDGISRLTALRVLDLSHCQNLLRIPEFSSSLQVLDVHSCTSLETLS

Gene3D: G3DSA:3.80.10.10
1144-1312 no description

LCLAGNEFYELPTIECPLALDSLCLRNCEKLESLPSDICKLKSLKSLFCSGCSELKSFPEIVENMENLRKLYLNQTAIEELPSSIDHLQGLQCLSVESCDNLVSLPESICNLTSLKVLVVDCCPKLYKLPENLGSLRSLEELYATHSYSIGCQLPSLSGLCSLRILDIQ

HMMSmart: SM00369
IPR003591
1208-1231 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MENLRKLYLNQTAIEELPSSIDHL

HMMSmart: SM00369
IPR003591
1303-1328 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LCSLRILDIQNSNLSQRAIPNDICCL

Gene3D: G3DSA:3.80.10.10
1313-1432 no description

NSNLSQRAIPNDICCLYSLKLLNLSNFNLIEGGIPREIYNLSSLQALLLGGNHFSSIPDGISRLTALRVLDLSHCQNLLRIPEFSSSLQVLDVHSCTSLETLSSPSNLLQSCLLKCFKSL

Seg: seg
1328-1341 seg

LYSLKLLNLSNFNL

HMMSmart: SM00369
IPR003591
1353-1376 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSSLQALLLGGNHFSSIPDGISRL

HMMPfam: PF00560
IPR001611
1379-1397 LRR_1
Leucine-rich repeat

LRVLDLSHCQNLLRIPEFS

Seg: seg
1520-1532 seg

SSESDIEYEDEID






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox