PRGDB00078978 (Vvi.21063)

From PRG Wiki
Jump to: navigation, search
Vvi.21063
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 225460041 (XM_002270705)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Vitis vinifera

Comment?

PREDICTED: Vitis vinifera hypothetical protein LOC100261885 (LOC100261885), mRNA

DNA Sequence

ATGGCCTCTTCTTCTTCCACTTCCCATTCTCAATGGAGTTACGATGTGTTTTTGAGTTTTAGAGGTGAAGATACTCGCAGAAACTTCACTGATCATCTCTACAAGGCTTTGATTCATAGCGGTATTAGAACCTTTAGAGATGATGAAGAACTTCGAAGGGGTGAAGAGATTGCACCAGAGCTCTTAAAAGCTATTGAGGAATCAAGGAGTGCCATTGTTGTCTTCTCAGAAACCTATGCTCGTTCCAAATGGTGTCTGGAAGAGCTTGTCAAGATCATGAAATGCAAAGAGGAAAGGGAACAAATGGTAGTTATCCCAATTTTCTATCATGTGGATCCGTCTGAAGTGCGGAACCAAACTGAGATTTACGGAGAAGCATTTACCCATCATGAGAAGAATGCAGAGGAGGAGAGAAAGGAAAAGATAAGGAAATGGAAGACTGCCCTGAGGCAAGCAAGCAATCTAGCCGGATATGATGCGACGAACAGGTACGAATCAGAGCTTATTGATGAAATTATTGAGAACGTCCTTAGAAGCTTCCCTAAGACTTTAGTTGTTAACGAGAACATTGTTGGAATGGATTCTCGTTTGGAAAGACTAATATCATTGTTAAAGATTGAGTTGAATGATGTTCGCATGGTCGGGGTTTATGGGCTTGGTGGTATCGGCAAGACCACCATCATCAATGCTCTTTATAACCGAATCTCAAATCAATTCGAAAGTGTTAGCTTGCTCACAGATGTCAGAAAAGAATCCACAGAAAATTCTGGTCTTCTTAAGTTACAACAACAACTTCTTAATGATACTCTAAGGACAACGAGGAAAATAGTTTTAAGGGATGTTCATGAAGGTATCAAAGAAATAAGGGACAAGCTTTCCTCAAAAAAGGTTCTTGTTTTTCTGGATGATGTAGATGAGCTGACACAATTAGAACACTTAATTGGAAAGCATGATTGGTTTGGTCCAGGAAGCAGAATCATCATTACTACTAGGAAAAAAGATTTGCTAACTAGGCATGAAGTAAATGATATGTATGAAGTTGAGAAATTATATTTTCACGAAGCTCTTCAACTTTTTTGCCGTTATGCCTTTAAACAACATCATCCGAAGGAAGGTTATGGAGATCTCTCTCATCAAGTAGTACAATATGCTGATGGTCTTCCATTAGCACTTAAAGTTTTGGGTTCTCTATTATTTGGAAAGAGACTACCAGATTGGAAAAGTGAATTGCAGAAGCTGGAAAAGGTGCCTAACATGGAAATTGTAAAAGTGCTTAAAATAAGTTTCGATGGATTGGATTATACACAAAGGATGATATTTCTCGACATTGCATGTTTCTTTAGAGGAGATGATGTGAAAAGAGTTTCAAGAATATTGGATGCTTCCGAATTCAATGCGGAAAGTGGAATAAATGCTCTCGTTGATAGGTGTTTCATAACCATTTCAAAGGACAACAGAATAGATATGCATGATTTGTTAGCCCAAATGGGCAAGGGCATTGTTGATCAAGAATGTCCTAATGAGCCAGGAGAGAGGAGCAGATTATGGAGACATATAGATATTTATCGAGTATTAAAAAGAAATACGTGTCTTAGAAATTTAAGGCGCATCAATCTCAGCGATTCACAACAACTCATTGAGCTACCAAATTTCTCAAACGTGCCAAATTTGGAGGAACTAATTCTTTCAGGTTGTATAATTTTACTTAAGCTCAATTGGGATCTCATTGCCACCTATGCATTCTCTGGTGAATTGCCTCAAATCAGCAAGTCAGCTTCTTATGAATTTGATGGAGCAAATGGGGTTGGAAATATGGTGAGTCGGGAGGAGCTACTGCCTGCCAGCTCACAAGTGTTTCCTGTTGCTAACAGAAGTCCTGGTTTGCTAGAGCTAGGCAACCGAGAACCAGGAACTCAATCCAAGTCTTTTGATAGGATTTCACTACTGCAGATTGGAGTTCACAGGCCTCTACCTGATTCCAAGGTTACTCGAAAAACTGTTAAGATCCCCTTTGATCGTTTTAGACCTAAGGTCATAACAATAGAGGAATGGAACACTGTTGATTCAATAAAGCCAGATGAGATAGTTGGCTTCCTTCAATTGGAGATGACTCCAAGTGTTCCTAAGAAAAAGAAACATTAA


Protein sequences

Name Description Sequence
Vvi.21063 translated coding region predicted by ESTScan from UniGene Vvi.21063

MASSSSTSHSQWSYDVFLSFRGEDTRRNFTDHLYKALIHSGIRTFRDDEELRRGEEIAPELLKAIEESRSAIVVFSETYARSKWCLEELVKIMKCKEEREQMVVIPIFYHVDPSEVRNQTEIYGEAFTHHEKNAEEERKEKIRKWKTALRQASNLAGYDATNRYESELIDEIIENVLRSFPKTLVVNENIVGMDSRLERLISLLKIELNDVRMVGVYGLGGIGKTTIINALYNRISNQFESVSLLTDVRKESTENSGLLKLQQQLLNDTLRTTRKIVLRDVHEGIKEIRDKLSSKKVLVFLDDVDELTQLEHLIGKHDWFGPGSRIIITTRKKDLLTRHEVNDMYEVEKLYFHEALQLFCRYAFKQHHPKEGYGDLSHQVVQYADGLPLALKVLGSLLFGKRLPDWKSELQKLEKVPNMEIVKVLKISFDGLDYTQRMIFLDIACFFRGDDVKRVSRILDASEFNAESGINALVDRCFITISKDNRIDMHDLLAQMGKGIVDQECPNEPGERSRLWRHIDIYRVLKRNTCLRNLRRINLSDSQQLIELPNFSNVPNLEELILSGCIILLKLNWDLIATYAFSGELPQISKSASYEFDGANGVGNMVSREELLPASSQVFPVANRSPGLLELGNREPGTQSKSFDRISLLQIGVHRPLPDSKVTRKTVKIPFDRFRPKVITIEEWNTVDSIKPDEIVGFLQLEMTPSVPKKKKH

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
2-158 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

ASSSSTSHSQWSYDVFLSFRGEDTRRNFTDHLYKALIHSGIRTFRDDEELRRGEEIAPELLKAIEESRSAIVVFSETYARSKWCLEELVKIMKCKEEREQMVVIPIFYHVDPSEVRNQTEIYGEAFTHHEKNAEEERKEKIRKWKTALRQASNLAGY

Seg: seg
3-13 seg

SSSSTSHSQWS

Gene3D: G3DSA:3.40.50.10140
9-152 no description

HSQWSYDVFLSFRGEDTRRNFTDHLYKALIHSGIRTFRDDEELRRGEEIAPELLKAIEESRSAIVVFSETYARSKWCLEELVKIMKCKEEREQMVVIPIFYHVDPSEVRNQTEIYGEAFTHHEKNAEEERKEKIRKWKTALRQA

ProfileScan: PS50104
IPR000157
12-155 TIR
Toll-Interleukin receptor

WSYDVFLSFRGEDTRRNFTDHLYKALIHSGIRTFRDDEELRRGEEIAPELLKAIEESRSAIVVFSETYARSKWCLEELVKIMKCKEEREQMVVIPIFYHVDPSEVRNQTEIYGEAFTHHEKNAEEERKEKIRKWKTALRQASNL

HMMSmart: SM00255
IPR000157
13-155 Toll
Toll/interleukin-1 receptor homology (TIR) domain

SYDVFLSFRGEDTRRNFTDHLYKALIHSGIRTFRDDEELRRGEEIAPELLKAIEESRSAIVVFSETYARSKWCLEELVKIMKCKEEREQMVVIPIFYHVDPSEVRNQTEIYGEAFTHHEKNAEEERKEKIRKWKTALRQASNL

HMMPfam: PF01582
IPR000157
16-150 TIR
Toll-Interleukin receptor

VFLSFRGEDTRRNFTDHLYKALIHSGIRTFRDDEELRRGEEIAPELLKAIEESRSAIVVFSETYARSKWCLEELVKIMKCKEEREQMVVIPIFYHVDPSEVRNQTEIYGEAFTHHEKNAEEERKEKIRKWKTALR

HMMPanther: PTHR11017:SF20
39-560 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

HSGIRTFRDDEELRRGEEIAPELLKAIEESRSAIVVFSETYARSKWCLEELVKIMKCKEEREQMVVIPIFYHVDPSEVRNQTEIYGEAFTHHEKNAEEERKEKIRKWKTALRQASNLAGYDATNRYESELIDEIIENVLRSFPKTLVVNENIVGMDSRLERLISLLKIELNDVRMVGVYGLGGIGKTTIINALYNRISNQFESVSLLTDVRKESTENSGLLKLQQQLLNDTLRTTRKIVLRDVHEGIKEIRDKLSSKKVLVFLDDVDELTQLEHLIGKHDWFGPGSRIIITTRKKDLLTRHEVNDMYEVEKLYFHEALQLFCRYAFKQHHPKEGYGDLSHQVVQYADGLPLALKVLGSLLFGKRLPDWKSELQKLEKVPNMEIVKVLKISFDGLDYTQRMIFLDIACFFRGDDVKRVSRILDASEFNAESGINALVDRCFITISKDNRIDMHDLLAQMGKGIVDQECPNEPGERSRLWRHIDIYRVLKRNTCLRNLRRINLSDSQQLIELPNFSNVPNLEEL

HMMPanther: PTHR11017
39-560 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

HSGIRTFRDDEELRRGEEIAPELLKAIEESRSAIVVFSETYARSKWCLEELVKIMKCKEEREQMVVIPIFYHVDPSEVRNQTEIYGEAFTHHEKNAEEERKEKIRKWKTALRQASNLAGYDATNRYESELIDEIIENVLRSFPKTLVVNENIVGMDSRLERLISLLKIELNDVRMVGVYGLGGIGKTTIINALYNRISNQFESVSLLTDVRKESTENSGLLKLQQQLLNDTLRTTRKIVLRDVHEGIKEIRDKLSSKKVLVFLDDVDELTQLEHLIGKHDWFGPGSRIIITTRKKDLLTRHEVNDMYEVEKLYFHEALQLFCRYAFKQHHPKEGYGDLSHQVVQYADGLPLALKVLGSLLFGKRLPDWKSELQKLEKVPNMEIVKVLKISFDGLDYTQRMIFLDIACFFRGDDVKRVSRILDASEFNAESGINALVDRCFITISKDNRIDMHDLLAQMGKGIVDQECPNEPGERSRLWRHIDIYRVLKRNTCLRNLRRINLSDSQQLIELPNFSNVPNLEEL

Seg: seg
131-146 seg

EKNAEEERKEKIRKWK

superfamily: SSF52540
171-421 P-loop containing nucleoside triphosphate hydrolases

EIIENVLRSFPKTLVVNENIVGMDSRLERLISLLKIELNDVRMVGVYGLGGIGKTTIINALYNRISNQFESVSLLTDVRKESTENSGLLKLQQQLLNDTLRTTRKIVLRDVHEGIKEIRDKLSSKKVLVFLDDVDELTQLEHLIGKHDWFGPGSRIIITTRKKDLLTRHEVNDMYEVEKLYFHEALQLFCRYAFKQHHPKEGYGDLSHQVVQYADGLPLALKVLGSLLFGKRLPDWKSELQKLEKVPNMEI

Gene3D: G3DSA:3.40.50.300
187-338 no description

NENIVGMDSRLERLISLLKIELNDVRMVGVYGLGGIGKTTIINALYNRISNQFESVSLLTDVRKESTENSGLLKLQQQLLNDTLRTTRKIVLRDVHEGIKEIRDKLSSKKVLVFLDDVDELTQLEHLIGKHDWFGPGSRIIITTRKKDLLTR

HMMPfam: PF00931
IPR002182
195-458 NB-ARC,NBS
NB-ARC

SRLERLISLLKIELNDVRMVGVYGLGGIGKTTIINALYNRISNQFESVSLLTDVRKESTENSGLLKLQQQLLNDTLRTTRKIVLRDVHEGIKEIRDKLSSKKVLVFLDDVDELTQLEHLIGKHDWFGPGSRIIITTRKKDLLTRHEVNDMYEVEKLYFHEALQLFCRYAFKQHHPKEGYGDLSHQVVQYADGLPLALKVLGSLLFGKRLPDWKSELQKLEKVPNMEIVKVLKISFDGLDYTQRMIFLDIACFFRGDDVKRVSRI

FPrintScan: PR00364
IPR000767
213-228 DISEASERSIST
Disease resistance protein

MVGVYGLGGIGKTTII

FPrintScan: PR00364
IPR000767
291-305 DISEASERSIST
Disease resistance protein

KLSSKKVLVFLDDVD

FPrintScan: PR00364
IPR000767
384-398 DISEASERSIST
Disease resistance protein

ADGLPLALKVLGSLL

superfamily: SSF52058
500-567 L domain-like,LRR

IVDQECPNEPGERSRLWRHIDIYRVLKRNTCLRNLRRINLSDSQQLIELPNFSNVPNLEELILSGCII

Gene3D: G3DSA:3.80.10.10
513-567 no description

SRLWRHIDIYRVLKRNTCLRNLRRINLSDSQQLIELPNFSNVPNLEELILSGCII

FPrintScan: PR00364
IPR000767
529-545 DISEASERSIST
Disease resistance protein

TCLRNLRRINLSDSQQL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox