PRGDB00078983 (Vvi.21298)

From PRG Wiki
Jump to: navigation, search
Vvi.21298
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 156730046 (EV234167)
Gene Class T
Domain Type TIR, LRR
Gene Species Vitis vinifera

Comment?

VV_PEb12e05.b1 Vitis vinifera cv. perlette LibB Vitis vinifera cDNA, mRNA sequence

DNA Sequence

TTTTGGTTTTTnnnnnnnnnnCCAGGGGATGGCATACGGCCGGGGATCAATACCTTCTTCTCCTCTCAATTCTTCTTCTACTGAACGTGTGTTATGATGTTTTCTTGAGTTTTAGAGGAGAAGATACCCGCACAGGATTTACAGACCATCGCTACGCGGCTTTAGTTGACAAAGGAATCCGTACCTTTACAGACAGTGAACAACTTCGACGTGGAGAAGAGGTTGAAGGAGAACTTCTGAAAGCTATCCATGAATCAAGAATTTTCATCATTATTTTCTCAGAAGACTATGCTAACTCCAAGTGGTGTTTAAAAGAACTCGCGGAGATCAGTAAGTGCAAAGCAAAGGGACCAAAAGTTTTTCCAGTTTTCTACCATGTAGATCCAAGCGAAGTGCGAAATCAGTCTGGATATTATGGAGAAGCATTCGCAGCTTATGAAAACGATGCGAACCAAGACAGTGAGCGAATACAAGTATGGAGGACTGCCTTGAAGGAAGCAGGCCATATAATTGGATATCATATAGATAAAGAGTAACTATACCTTCTCTTCATCTCCCTCTGCGTATTTTCTCACTAGCTGACTTGATTTTATCTATTATTACTCTCAAAAAACTTGGGCCATTTGAGTATAAGTTTTTTTCCGCATGATTTCGTGGAAGCCCATTTCTCTATCCATTTGATCTCTTCATTTTAATTATGAGCAGTATTGTATAAATGGTTGTGCCCTGGACATAGATTTAAGGGGAACATATTGGGCGTTTTAAGATTTAATATTGAAGATaaaaaaccataaaaagtgcgaaaaaaaaaaaaaGCCTTATTGGGTGTTGGCGTGTTCGGCCCCCTCGAGCCCATTCAAACTTAGACCTCAAGAAAGCTTTTGGAATGCGGCCCGCTATTTCGAGCCTCATTTGGGCCAATTCCGCCCTTATTGTGGGGGATGGAATTAACAATTTTCACGTGCGCCGTCCGGTTTTTAAAACGGTCCGTGGCCGTGGGAAAAAAACCCCTGGCGGTTTACCACAATTTTAAAACCGCCCGTTGGCAAACAACATCCCCCCCTTTTTTGAACAGAGGGGGGGTTTATAAAGGCGGAAAGAAGGCCCCCCCACCCGGAATCTCCCCCTTTTCTCCAAAAAGTATGGCCTCCACACCGCGGTAGAGGGGCGAAATGCGAAAAATTGTGCAANAGCGCTCTAAAAATCTCTGTTGAGAAAGAACTCTCCGCGCGATAATAATATATTGTGTTTATAACTCCACGCCC


Protein sequences

Name Description Sequence
Vvi.21298 translated coding region predicted by ESTScan from UniGene Vvi.21298

XLVFXXXXRGWHTAGDQYLLLLSILLLLNVCYDVFLSFRGEDTRTGFTDHRYAALVDKGIRTFTDSEQLRRGEEVEGELLKAIHESRIFIIIFSEDYANSKWCLKELAEISKCKAKGPKVFPVFYHVDPSEVRNQSGYYGEAFAAYENDANQDSERIQVWRTALKEAGHIIGYHIDKE

Domains

Domain Start-End Description Sequence

Seg: seg
19-28 seg

LLLLSILLLL

superfamily: SSF52200
IPR000157
20-173 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

LLLSILLLLNVCYDVFLSFRGEDTRTGFTDHRYAALVDKGIRTFTDSEQLRRGEEVEGELLKAIHESRIFIIIFSEDYANSKWCLKELAEISKCKAKGPKVFPVFYHVDPSEVRNQSGYYGEAFAAYENDANQDSERIQVWRTALKEAGHIIGY

Gene3D: G3DSA:3.40.50.10140
30-164 no description

VCYDVFLSFRGEDTRTGFTDHRYAALVDKGIRTFTDSEQLRRGEEVEGELLKAIHESRIFIIIFSEDYANSKWCLKELAEISKCKAKGPKVFPVFYHVDPSEVRNQSGYYGEAFAAYENDANQDSERIQVWRTAL

ProfileScan: PS50104
IPR000157
30-170 TIR
Toll-Interleukin receptor

VCYDVFLSFRGEDTRTGFTDHRYAALVDKGIRTFTDSEQLRRGEEVEGELLKAIHESRIFIIIFSEDYANSKWCLKELAEISKCKAKGPKVFPVFYHVDPSEVRNQSGYYGEAFAAYENDANQDSERIQVWRTALKEAGHI

HMMSmart: SM00255
IPR000157
31-170 Toll
Toll/interleukin-1 receptor homology (TIR) domain

CYDVFLSFRGEDTRTGFTDHRYAALVDKGIRTFTDSEQLRRGEEVEGELLKAIHESRIFIIIFSEDYANSKWCLKELAEISKCKAKGPKVFPVFYHVDPSEVRNQSGYYGEAFAAYENDANQDSERIQVWRTALKEAGHI

HMMPfam: PF01582
IPR000157
34-165 TIR
Toll-Interleukin receptor

VFLSFRGEDTRTGFTDHRYAALVDKGIRTFTDSEQLRRGEEVEGELLKAIHESRIFIIIFSEDYANSKWCLKELAEISKCKAKGPKVFPVFYHVDPSEVRNQSGYYGEAFAAYENDANQDSERIQVWRTALK

HMMPanther: PTHR23155:SF247
43-175 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

TRTGFTDHRYAALVDKGIRTFTDSEQLRRGEEVEGELLKAIHESRIFIIIFSEDYANSKWCLKELAEISKCKAKGPKVFPVFYHVDPSEVRNQSGYYGEAFAAYENDANQDSERIQVWRTALKEAGHIIGYHI

HMMPanther: PTHR23155
43-175 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TRTGFTDHRYAALVDKGIRTFTDSEQLRRGEEVEGELLKAIHESRIFIIIFSEDYANSKWCLKELAEISKCKAKGPKVFPVFYHVDPSEVRNQSGYYGEAFAAYENDANQDSERIQVWRTALKEAGHIIGYHI

Seg: seg
67-80 seg

EQLRRGEEVEGELL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox