PRGDB00079045 (Vvi.24261)

From PRG Wiki
Jump to: navigation, search
Vvi.24261
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 193878339 (EU812234)
Gene Class Mlo-like
Domain Type MLO
Gene Species Vitis vinifera

Comment?

Vitis vinifera MLO-like protein 3 (MLO3) mRNA, complete cds

DNA Sequence

ATATTGCACAATCATTTCGAGTGACACAACTGCAAATTACTACTTTTTAGGAAGCAGGCCATATAGAAAGGATATGGCTAAGGGATCAAAGGATCGATCTTTGGAGCAAACACCGACTTGGGCGGTTGCAGTGGTCTGTTTTGTGCTGGTTTTGATATCAATTATCATCGAATACATCCTTCACTTAATTGGAAAGTGGCTAACAAAGAGAAACAAACGAGCTCTTTATGAAGCACTTGAAAAGATTAAGTCAGAACTTATGCTACTGGGGTTCATATCGCTGCTCCTAACGGTAGGACAAGGAACTATTGCGGGAATATGCATATCAGAGAAGATTGCAGCAACCTGGCACCCATGTGGGAAGAAACAAGAAATCAAGTATGTTTCTAATGAAGAAGATTATGGCAAGAGAAGGCTTCTTGAAATTTCAGATTCCGATGGAAGTAATCGACGTGTGTTAGCGGCCGCGGGAGATGACAAATGTGGAGAGGGTAAAGTCCCGTTTGTCTCCAATTATGGGATCCACCAACTTCACATATTCATCTTCGTTCTTGCTGTTTTCCACGTACTTTATTGTATAATCACATTGGCTTTGGGCAGAGCTAAGATGAGGAAGTGGAAGGCGTGGGAAATGGAAACAAGAACAGCCGAGTACCGGTTCGCAAACGATCCAGAGAGATTTAGGTTTGCAAGAGACACCTCATTTGGGAGAAGGCATTTGCACTCCTGGAGCACCTCCCCAGTTCTCCTTTGGATTGTGTGTTTCTTCAGACAATTTGTCAGATCAGTTCCCAAAGTTGATTACTTGACCTTGCGCCATGGGTTTATCATTGCACATTTGGCACCCGAGAGTCATACTAGATTTGATTTCCAGAAATACATCAAGAGATCACTCGAGGAGGATTTCAAAGTTGTAGTCGGTATCAGTCCAATAATCTGGTTCTGTGCTGTACTCTTCCTACTATTCAACACCCATGGTTGGCATTCTTATCTATGGTTACCCTTTATCCCACTAATTATCATCCTGATGGTGGGGACAAAACTACAAGTTATCATAACAAAGATGGGGCTGAGAATACAGGAGAGAGGAGAGGTGGTAAAAGGAACCCCAGTGGTGGAGCCTGGTGATGATCTTTTCTGGTTCAACCAGCCACGTCTCATTCTCTACCTGATTAACTTTGTTCTCTTTCAGAACGCATTCCAGGTTGCCTTCTTTGCATGGACCTGGTATGAGTTTGGCTTGAAATCTTGTTTCCACGAAAGGATAGAAGATGTGGTCATCCGCATATCAATGGGAGTCATAGTACAAATACTCTGCAGCTATGTGACTCTTCCTCTGTATGCCTTGGTTACACAGATGGGATCTACCATGAAGCCCACCATCTTCAATGACAGAGTGGCGAAAGCTCTGAGAAACTGGCACCACGCTGCAAGGAAGCACATAAAACAGAGCAAGCAATCAAGCGCTGTGACCCCTGTATCAAGTAGGGCAGGCACTCCCTTTTCAAGTAGGCCAGGCACCCCCTTACATGGCATGTCCCCTGTTCATCTACTCCGCCACCACCGCAGTGAGCTCGACAGTGTTCAAACATCTCCTAGAATGTCCAATTTTGACAATGAAGGTCCGGAGACAGACGAGTATCGCCACCGTGAGGATATATCATGGTCAGAACATCATAGAAATCCTGGTCCAGAAGAAGAGGGGAGGGACACAAATCATAGGATCTTGACCCGTACCATGCCAGCTCCTCAAGCTGACAATGCTCAGCACGAAATTGACATTCAGCCCATGGACTTTTCATTCGATAAAAGAGCAAGAACTTGAATAGAGTGATGAAGATTGGATTGAGGAAGCAAAGATGACAACAAAACCCATCCCTGGTTGTATAGTGGATACAATGTTGAACTTGCACCTTGGCCTTGTAttttttttttttttGAGGATCACTCGTATAGCTGTGGGCAACGAATTTTTCTGAAAAGTAACTCTTGTAGTTCTGTAAGTTTTAAATTTCGTTGTACCGTATATCATAAATTGTGAGCAGTCAAATTCTTACATGAGTTCTCGTGTAAGAATCAACTAAATGCCCAAAATCAAGCCAATGCTTTCCCCaaaaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Vvi.24261 translated coding region predicted by ESTScan from UniGene Vvi.24261

XYCTIISSDTTANYYFLGSRPYRKDMAKGSKDRSLEQTPTWAVAVVCFVLVLISIIIEYILHLIGKWLTKRNKRALYEALEKIKSELMLLGFISLLLTVGQGTIAGICISEKIAATWHPCGKKQEIKYVSNEEDYGKRRLLEISDSDGSNRRVLAAAGDDKCGEGKVPFVSNYGIHQLHIFIFVLAVFHVLYCIITLALGRAKMRKWKAWEMETRTAEYRFANDPERFRFARDTSFGRRHLHSWSTSPVLLWIVCFFRQFVRSVPKVDYLTLRHGFIIAHLAPESHTRFDFQKYIKRSLEEDFKVVVGISPIIWFCAVLFLLFNTHGWHSYLWLPFIPLIIILMVGTKLQVIITKMGLRIQERGEVVKGTPVVEPGDDLFWFNQPRLILYLINFVLFQNAFQVAFFAWTWYEFGLKSCFHERIEDVVIRISMGVIVQILCSYVTLPLYALVTQMGSTMKPTIFNDRVAKALRNWHHAARKHIKQSKQSSAVTPVSSRAGTPFSSRPGTPLHGMSPVHLLRHHRSELDSVQTSPRMSNFDNEGPETDEYRHREDISWSEHHRNPGPEEEGRDTNHRILTRTMPAPQADNAQHEIDIQPMDFSFDKRART

Domains

Domain Start-End Description Sequence

HMMPfam: PF03094
IPR004326
31-523 Mlo
Mlo-related protein

KDRSLEQTPTWAVAVVCFVLVLISIIIEYILHLIGKWLTKRNKRALYEALEKIKSELMLLGFISLLLTVGQGTIAGICISEKIAATWHPCGKKQEIKYVSNEEDYGKRRLLEISDSDGSNRRVLAAAGDDKCGEGKVPFVSNYGIHQLHIFIFVLAVFHVLYCIITLALGRAKMRKWKAWEMETRTAEYRFANDPERFRFARDTSFGRRHLHSWSTSPVLLWIVCFFRQFVRSVPKVDYLTLRHGFIIAHLAPESHTRFDFQKYIKRSLEEDFKVVVGISPIIWFCAVLFLLFNTHGWHSYLWLPFIPLIIILMVGTKLQVIITKMGLRIQERGEVVKGTPVVEPGDDLFWFNQPRLILYLINFVLFQNAFQVAFFAWTWYEFGLKSCFHERIEDVVIRISMGVIVQILCSYVTLPLYALVTQMGSTMKPTIFNDRVAKALRNWHHAARKHIKQSKQSSAVTPVSSRAGTPFSSRPGTPLHGMSPVHLLRHHR

Seg: seg
50-64 seg

LVLISIIIEYILHLI

Seg: seg
332-343 seg

LWLPFIPLIIIL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox