PRGDB00079106 (Vvi.25757)

From PRG Wiki
Jump to: navigation, search
Vvi.25757
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 225450347 (XM_002268892)
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Vitis vinifera

Comment?

PREDICTED: Vitis vinifera hypothetical protein LOC100240945 (LOC100240945), mRNA

DNA Sequence

ATGGCTGCCAGGTTCTTGCTTCTTCTTGTCCTTCCGTCTTTAGTTTTTTCTCAATATTGCACTGATCTTGATATTACCGCCTCCAACAACTCGCCTAGATGTGTATCACCTTCTGGTGAATTTGCGTTTGGGTTTTACCGCCTTGGCAGTCAAAGTCTCTTCTTGCTTGCTATCTGGTTCGAAAAAATACCAGAAAAAACCTTAGTTTGGTATGCAAATGGAGATAACCCGGCTCCTAAAGGATCCAAACTTGAACTTACCTCTGATGGCCAGTTCATACTAAGTGATCCACAAGGCAAAGAGATATGGAGACCTCAGAACTCTGTTACCGCGGTCACTCATGCTGCCATGCTTGATACTGGTAACTTTGTTCTTGAAAATAGGAATCAAAATCTTACAGTGTGGCAGAGCTTCCAGAATCCAGCCAACACCATCTTGCCAACTCAAACACTGGAAATCGGTGGCACCATGTATTCTCAGCAGTCAAACAGCAGCTACTCAAAGGGGAGGTTCCAGCTTCAAATGGAAGCTGGAGGCAATCTCGTACTTAATACCTTGGACCCAGAATCTGGTAAAGCATATGATGTTTATTATTCAAGCAACACCAATGATGCTGCAAATAGCGGCAATTCTGGCCAACGGGTGATTTTTGATGAGTCAGGTAGCATCTATGTTCTTCTAAGGAATGGAGGTACTGTTAACATCGCCTCCGGAAGTAGCTTGACGGGAGATTACTATTACCGGGCAACGCTTGACCAGGATGGAGTTTTCAGGCTATATAATCGTGACAACAGCAGTACTTCTTGGTCTGTTGTGAAAAACATTCCTGATAACATTTGTACCGTGACCCCAAGTAATCTTGGCAGTGGAATTTGTGGGTTCAACAGCTATTGTTCCATTGATGGAAGGGGGCTGCCTGATTGTCTATGCCCAGATGGGTACTCTCATTTGGATCCTCTTGACAGAAAACAAGGCTGTAAACCGAATTTTGAATTGCCCAGCTGCCAAACAGCTGTTGATGGATGGGAAGCAAACAAGGATGCAGTAGAGTTCAGAGAATTAAAAGATGTCAACTGGCCATTATCTGATTATCAACTTCAGGAGGGACCTGAATTCAACAAGGAGAAGTGTAAACAGTCTTGCAAAGATGATTGCCTCTGTGTGGTTGCTATCTATAACACTGACAATCAGTGTTGGAAGAAGAAGTTTCCTGTCTCAAATGGAAGACACGAACCAACACAAAATGTGCTCCAATACACTACTGCTCTCATCAAGGTACGGATTAAAAATGATACTATAGAGAGATGCCCAGACAAGTCTACCTTGATCCTTGTTGGGTCAGTACTCCTTGGCAGCTCTGTGTTGTTTAATCTCTTTTTGTTGTTAGCAATTCCTGCGGCTGCTCTCTTCTTCTACAACAAGAAACTGATGAATCTCCGGTCCGTTTCAAGCATATTCGCGACCACCAGTGTGAGAACTTATTCATACAAAGAACTTGACGAGGCAACCTGTGGATTCAAGGAGAAATTGGGCAGGGGAGCTTTTGGAACAGTATATAAAGGGGTTTTGGCATCAGATGCTGGGAGATTTGTGGCAGTCAAGAAGTTAGATAAGGTGGTACAGGAAGGTGAGAAGGAATTCAAAACAGAAGTCACTGTGATTGGGCGGACCCACCATAGGAATTTAGTCAGTTTGCTTGGATACTGTGATCAGGGGGTGCACCGGCTTCTGGTATACGAGTACATGAACAATGGATCTTTAGCAGACTTGTTGTTTGGAATATCTACACCTGACTGGAGCCAAAGACTACAGATTGCCTTTGGGATTGCAAAAGGGCTAATGTATTTACATGAAGAGTGCAGCACCCCCATCATCCATTGTGATATAAAGCCTGAAAACATCCTCCTTGACGAGTACCTTACACCTAGGATTTCAGACTTCGGACTAGCAAAGCTTCTGATGAGAGATCAAACTCGGGCCCTTACAACCATCAGAGGGACCAAAGGATACGTTGCACCAGAATGGTTCAGGAGCAAGCCGATTACGGTGAAAGTGGATGTTTATAGTTATGGGGTTATGTTACTGGAGATCATCAGTTGCAGGAAGAGCGTACATTCACAGCCAGAAAATGACGAGGAAGCAATACTTACTGATTGGGCTTATGATTGCTATAGAGGGCACAGATTGGATAAGCTAGTGAAGAATGATGATGAAGTAAGAAAGTACATGGGGATGCTGGAGAGGGTAGTGATGGTTGCCATTTGGTGCATTCAAGAGGACCCTTCTTTGAGGCCCTCCATGGGAATGGTCATACTGATGCTTGAAGGAGTTGTTGAAGTTCCTGTGCCCCCTTGTCCTTTCCCCTTTAGTTCAACCTTCTGAAACTACACATCCCTATGACAGTATATACGCACCTACTCATCTTTGTAATCCTGGGAGTTCCATATATCATGAACTTCAGTTGAATATATATGTTTGTTCTTATATAGTGTTTTCTTTGTTAGTATGGTTCCATTTTCTTGTTCTAATAGTACAAACAAGGTTGCTA


Protein sequences

Name Description Sequence
Vvi.25757 translated coding region predicted by ESTScan from UniGene Vvi.25757

MAARFLLLLVLPSLVFSQYCTDLDITASNNSPRCVSPSGEFAFGFYRLGSQSLFLLAIWFEKIPEKTLVWYANGDNPAPKGSKLELTSDGQFILSDPQGKEIWRPQNSVTAVTHAAMLDTGNFVLENRNQNLTVWQSFQNPANTILPTQTLEIGGTMYSQQSNSSYSKGRFQLQMEAGGNLVLNTLDPESGKAYDVYYSSNTNDAANSGNSGQRVIFDESGSIYVLLRNGGTVNIASGSSLTGDYYYRATLDQDGVFRLYNRDNSSTSWSVVKNIPDNICTVTPSNLGSGICGFNSYCSIDGRGLPDCLCPDGYSHLDPLDRKQGCKPNFELPSCQTAVDGWEANKDAVEFRELKDVNWPLSDYQLQEGPEFNKEKCKQSCKDDCLCVVAIYNTDNQCWKKKFPVSNGRHEPTQNVLQYTTALIKVRIKNDTIERCPDKSTLILVGSVLLGSSVLFNLFLLLAIPAAALFFYNKKLMNLRSVSSIFATTSVRTYSYKELDEATCGFKEKLGRGAFGTVYKGVLASDAGRFVAVKKLDKVVQEGEKEFKTEVTVIGRTHHRNLVSLLGYCDQGVHRLLVYEYMNNGSLADLLFGISTPDWSQRLQIAFGIAKGLMYLHEECSTPIIHCDIKPENILLDEYLTPRISDFGLAKLLMRDQTRALTTIRGTKGYVAPEWFRSKPITVKVDVYSYGVMLLEIISCRKSVHSQPENDEEAILTDWAYDCYRGHRLDKLVKNDDEVRKYMGMLERVVMVAIWCIQEDPSLRPSMGMVILMLEGVVEVPVPPCPFPFSSTF

Domains

Domain Start-End Description Sequence

ProfileScan: PS50927
IPR001480
20-138 BULB_LECTIN
Bulb-type lectin domain

CTDLDITASNNSPRCVSPSGEFAFGFYRLGSQSLFLLAIWFEKIPEKTLVWYANGDNPAPKGSKLELTSDGQFILSDPQGKEIWRPQNSVTAVTHAAMLDTGNFVLENRNQNLTVWQSF

HMMSmart: SM00108
IPR001480
24-141 B_lectin
Bulb-type lectin domain

DITASNNSPRCVSPSGEFAFGFYRLGSQSLFLLAIWFEKIPEKTLVWYANGDNPAPKGSKLELTSDGQFILSDPQGKEIWRPQNSVTAVTHAAMLDTGNFVLENRNQNLTVWQSFQNP

HMMPanther: PTHR24420
36-793 PTHR24420,FAMILY NOT NAMED

SPSGEFAFGFYRLGSQSLFLLAIWFEKIPEKTLVWYANGDNPAPKGSKLELTSDGQFILSDPQGKEIWRPQNSVTAVTHAAMLDTGNFVLENRNQNLTVWQSFQNPANTILPTQTLEIGGTMYSQQSNSSYSKGRFQLQMEAGGNLVLNTLDPESGKAYDVYYSSNTNDAANSGNSGQRVIFDESGSIYVLLRNGGTVNIASGSSLTGDYYYRATLDQDGVFRLYNRDNSSTSWSVVKNIPDNICTVTPSNLGSGICGFNSYCSIDGRGLPDCLCPDGYSHLDPLDRKQGCKPNFELPSCQTAVDGWEANKDAVEFRELKDVNWPLSDYQLQEGPEFNKEKCKQSCKDDCLCVVAIYNTDNQCWKKKFPVSNGRHEPTQNVLQYTTALIKVRIKNDTIERCPDKSTLILVGSVLLGSSVLFNLFLLLAIPAAALFFYNKKLMNLRSVSSIFATTSVRTYSYKELDEATCGFKEKLGRGAFGTVYKGVLASDAGRFVAVKKLDKVVQEGEKEFKTEVTVIGRTHHRNLVSLLGYCDQGVHRLLVYEYMNNGSLADLLFGISTPDWSQRLQIAFGIAKGLMYLHEECSTPIIHCDIKPENILLDEYLTPRISDFGLAKLLMRDQTRALTTIRGTKGYVAPEWFRSKPITVKVDVYSYGVMLLEIISCRKSVHSQPENDEEAILTDWAYDCYRGHRLDKLVKNDDEVRKYMGMLERVVMVAIWCIQEDPSLRPSMGMVILMLEGVVEVPVPPCPFPFSSTF

HMMPanther: PTHR24420:SF815
36-793 PTHR24420:SF815

SPSGEFAFGFYRLGSQSLFLLAIWFEKIPEKTLVWYANGDNPAPKGSKLELTSDGQFILSDPQGKEIWRPQNSVTAVTHAAMLDTGNFVLENRNQNLTVWQSFQNPANTILPTQTLEIGGTMYSQQSNSSYSKGRFQLQMEAGGNLVLNTLDPESGKAYDVYYSSNTNDAANSGNSGQRVIFDESGSIYVLLRNGGTVNIASGSSLTGDYYYRATLDQDGVFRLYNRDNSSTSWSVVKNIPDNICTVTPSNLGSGICGFNSYCSIDGRGLPDCLCPDGYSHLDPLDRKQGCKPNFELPSCQTAVDGWEANKDAVEFRELKDVNWPLSDYQLQEGPEFNKEKCKQSCKDDCLCVVAIYNTDNQCWKKKFPVSNGRHEPTQNVLQYTTALIKVRIKNDTIERCPDKSTLILVGSVLLGSSVLFNLFLLLAIPAAALFFYNKKLMNLRSVSSIFATTSVRTYSYKELDEATCGFKEKLGRGAFGTVYKGVLASDAGRFVAVKKLDKVVQEGEKEFKTEVTVIGRTHHRNLVSLLGYCDQGVHRLLVYEYMNNGSLADLLFGISTPDWSQRLQIAFGIAKGLMYLHEECSTPIIHCDIKPENILLDEYLTPRISDFGLAKLLMRDQTRALTTIRGTKGYVAPEWFRSKPITVKVDVYSYGVMLLEIISCRKSVHSQPENDEEAILTDWAYDCYRGHRLDKLVKNDDEVRKYMGMLERVVMVAIWCIQEDPSLRPSMGMVILMLEGVVEVPVPPCPFPFSSTF

Gene3D: G3DSA:2.90.10.10
IPR001480
54-143 Bulb-type_lectin_dom
Bulb-type lectin domain

FLLAIWFEKIPEKTLVWYANGDNPAPKGSKLELTSDGQFILSDPQGKEIWRPQNSVTAVTHAAMLDTGNFVLENRNQNLTVWQSFQNPAN

superfamily: SSF51110
IPR001480
56-206 B_lectin
Bulb-type lectin domain

LAIWFEKIPEKTLVWYANGDNPAPKGSKLELTSDGQFILSDPQGKEIWRPQNSVTAVTHAAMLDTGNFVLENRNQNLTVWQSFQNPANTILPTQTLEIGGTMYSQQSNSSYSKGRFQLQMEAGGNLVLNTLDPESGKAYDVYYSSNTNDAA

HMMPfam: PF01453
IPR001480
66-165 B_lectin
Bulb-type lectin domain

KTLVWYANGDNPAPKGSKLELTSDGQFILSDPQGKEIWRPQNSVTAVTHAAMLDTGNFVLENRNQNLTVWQSFQNPANTILPTQTLEIGGTMYSQQSNSS

Gene3D: G3DSA:2.90.10.10
IPR001480
148-270 Bulb-type_lectin_dom
Bulb-type lectin domain

TQTLEIGGTMYSQQSNSSYSKGRFQLQMEAGGNLVLNTLDPESGKAYDVYYSSNTNDAANSGNSGQRVIFDESGSIYVLLRNGGTVNIASGSSLTGDYYYRATLDQDGVFRLYNRDNSSTSWS

Gene3D: G3DSA:2.60.120.200
IPR013320
437-524 ConA_like_subgrp
Concanavalin A-like lectin/glucanase, subgroup

PDKSTLILVGSVLLGSSVLFNLFLLLAIPAAALFFYNKKLMNLRSVSSIFATTSVRTYSYKELDEATCGFKEKLGRGAFGTVYKGVLA

superfamily: SSF56112
IPR011009
474-774 Kinase_like
Protein kinase-like domain

KKLMNLRSVSSIFATTSVRTYSYKELDEATCGFKEKLGRGAFGTVYKGVLASDAGRFVAVKKLDKVVQEGEKEFKTEVTVIGRTHHRNLVSLLGYCDQGVHRLLVYEYMNNGSLADLLFGISTPDWSQRLQIAFGIAKGLMYLHEECSTPIIHCDIKPENILLDEYLTPRISDFGLAKLLMRDQTRALTTIRGTKGYVAPEWFRSKPITVKVDVYSYGVMLLEIISCRKSVHSQPENDEEAILTDWAYDCYRGHRLDKLVKNDDEVRKYMGMLERVVMVAIWCIQEDPSLRPSMGMVILML

ProfileScan: PS50011
IPR000719
504-778 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

CGFKEKLGRGAFGTVYKGVLASDAGRFVAVKKLDKVVQEGEKEFKTEVTVIGRTHHRNLVSLLGYCDQGVHRLLVYEYMNNGSLADLLFGISTPDWSQRLQIAFGIAKGLMYLHEECSTPIIHCDIKPENILLDEYLTPRISDFGLAKLLMRDQTRALTTIRGTKGYVAPEWFRSKPITVKVDVYSYGVMLLEIISCRKSVHSQPENDEEAILTDWAYDCYRGHRLDKLVKNDDEVRKYMGMLERVVMVAIWCIQEDPSLRPSMGMVILMLEGVV

HMMPfam: PF00069
IPR017442
507-768 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

KEKLGRGAFGTVYKGVLASDAGRFVAVKKLDKVVQEGEKEFKTEVTVIGRTHHRNLVSLLGYCDQGVHRLLVYEYMNNGSLADLLFGISTPDWSQRLQIAFGIAKGLMYLHEECSTPIIHCDIKPENILLDEYLTPRISDFGLAKLLMRDQTRALTTIRGTKGYVAPEWFRSKPITVKVDVYSYGVMLLEIISCRKSVHSQPENDEEAILTDWAYDCYRGHRLDKLVKNDDEVRKYMGMLERVVMVAIWCIQEDPSLRPSMG

PatternScan: PS00107
IPR017441
510-535 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGAFGTVYKGVLASDAGRFVAVKK

Gene3D: G3DSA:3.30.200.20
525-569 G3DSA:3.30.200.20

SDAGRFVAVKKLDKVVQEGEKEFKTEVTVIGRTHHRNLVSLLGYC

Gene3D: G3DSA:1.10.510.10
570-766 G3DSA:1.10.510.10

DQGVHRLLVYEYMNNGSLADLLFGISTPDWSQRLQIAFGIAKGLMYLHEECSTPIIHCDIKPENILLDEYLTPRISDFGLAKLLMRDQTRALTTIRGTKGYVAPEWFRSKPITVKVDVYSYGVMLLEIISCRKSVHSQPENDEEAILTDWAYDCYRGHRLDKLVKNDDEVRKYMGMLERVVMVAIWCIQEDPSLRPS

PatternScan: PS00108
IPR008271
624-636 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHCDIKPENILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox