PRGDB00079153 (Bdi.3051)

From PRG Wiki
Jump to: navigation, search
Bdi.3051
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 78014110 (DV482498)
Gene Class Unknown
Domain Type
Gene Species Ricinus communis

Comment?

5382_B07_D14Z_061 Brachypodium distachyon leaf EST library Brachypodium distachyon cDNA clone 5382_B07_D14, mRNA sequence

DNA Sequence

CCACGCGTCCGCAAGTCCCCTACCCCAGCAGCTCCTCCGGCTTGCTGACGAGAACAGCAAGATGGACTACGTGTATGGGCCGGGCCGGAACCACCTGTTCGTGCCGGGGCCCGTGAACATCCCGGACCCGGTGATCCGGGCCATGAGCCGGCAGAACGAGGACTACCGCTCCCCGGCGGTGCCGGCGCTGACCAAGACGCTCCTGGAGGACGTGAAGAAGATCTTCAAGACGACCACGGGCACCCCTTTCCTGTTCCCCACCACGGGCACCGGCGCCTGGGAGAGCGCGCTCACCAACACTCTCTCCCCCGGCGACCGCATCGTCTCCTTCTCCCTCGGCCAGTTCAGCCTCCTCTGGATCGACCAGCAGCAGCGCCTCAACTTCCAGGTCGACGTCGTCGAGAGCGACTGGGGCCATGGCGCCGACCTCGGCGCCCTAGAGACCAAGCTCAGCCAGGACGCGGCGCACACCATTAAGGCCGTCTGCATCGTCCACAACGAGACCGCCACCGGCGTCACCAACGACCTCCACGCCGTCCGCAAGCTCCTCGATGCGTACAGGCACCCGGCGCTGCTGCTGGTGGACGGGGTGTCGTCGATCTGCGCGCTGGACTTCCGCATGGACGAGTGGGGGGGTGGACGTGGCGCTGACGGGGTCGCAGAAGGCGCTGTCGCTGCCGACGGGGCTGGGGATCGTGTGCGCCAGCCCGAGGGCGCTCGAGGCAAGCAAGACGGCCAAGTCCGTCAGGGTCTTCTTCGACTGGAAGGACTACCTCAAGTTCTACAAGATGGGCACATACTGGCCTTACACGCCTTTCATCCAGCTCCTCTACGGCCTCCGCGCCGGGCTCGACCTCATCTTC


Protein sequences

Name Description Sequence
Bdi.3051 translated coding region predicted by ESTScan from UniGene Bdi.3051

XHASASPLPQQLLRLADENSKMDYVYGPGRNHLFVPGPVNIPDPVIRAMSRQNEDYRSPAVPALTKTLLEDVKKIFKTTTGTPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLNFQVDVVESDWGHGADLGALETKLSQDAAHTIKAVCIVHNETATGVTNDLHAVRKLLDAYRHPALLLVDGVSSICALDFRMDEWGGGRGADGVAEGAVAADGAGDRVRQPEGARGKQDGQVRQGLLRLEGLPQVLQDGHILALHAFHPAPLRPPRRARPHLX

Domains

Domain Start-End Description Sequence

superfamily: SSF53383
IPR015424
12-212 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

LLRLADENSKMDYVYGPGRNHLFVPGPVNIPDPVIRAMSRQNEDYRSPAVPALTKTLLEDVKKIFKTTTGTPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLNFQVDVVESDWGHGADLGALETKLSQDAAHTIKAVCIVHNETATGVTNDLHAVRKLLDAYRHPALLLVDGVSSICALDFRMDEWG

HMMPanther: PTHR21152:SF7
20-212 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

SKMDYVYGPGRNHLFVPGPVNIPDPVIRAMSRQNEDYRSPAVPALTKTLLEDVKKIFKTTTGTPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLNFQVDVVESDWGHGADLGALETKLSQDAAHTIKAVCIVHNETATGVTNDLHAVRKLLDAYRHPALLLVDGVSSICALDFRMDEWG

HMMPanther: PTHR21152
20-212 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

SKMDYVYGPGRNHLFVPGPVNIPDPVIRAMSRQNEDYRSPAVPALTKTLLEDVKKIFKTTTGTPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLNFQVDVVESDWGHGADLGALETKLSQDAAHTIKAVCIVHNETATGVTNDLHAVRKLLDAYRHPALLLVDGVSSICALDFRMDEWG

HMMPfam: PF00266
IPR000192
33-212 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

LFVPGPVNIPDPVIRAMSRQNEDYRSPAVPALTKTLLEDVKKIFKTTTGTPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLNFQVDVVESDWGHGADLGALETKLSQDAAHTIKAVCIVHNETATGVTNDLHAVRKLLDAYRHPALLLVDGVSSICALDFRMDEWG

Gene3D: G3DSA:3.40.640.10
IPR015421
43-220 no description
Pyridoxal phosphate-dependent transferase, major r

DPVIRAMSRQNEDYRSPAVPALTKTLLEDVKKIFKTTTGTPFLFPTTGTGAWESALTNTLSPGDRIVSFSLGQFSLLWIDQQQRLNFQVDVVESDWGHGADLGALETKLSQDAAHTIKAVCIVHNETATGVTNDLHAVRKLLDAYRHPALLLVDGVSSICALDFRMDEWGGGRGADGV

Seg: seg
78-92 seg

TTTGTPFLFPTTGTG

Seg: seg
212-235 seg

GGGRGADGVAEGAVAADGAGDRVR

Seg: seg
266-288 seg

HILALHAFHPAPLRPPRRARPHL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox