PRGDB00079332 (Bra.2386)

From PRG Wiki
Jump to: navigation, search
Bra.2386
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 156802779 (EX029033)
Gene Class Unknown
Domain Type
Gene Species Poa pratensis

Comment?

BR013677 callus cDNA library KBCG Brassica rapa subsp. pekinensis cDNA clone KBCG-070D09 5', mRNA sequence

DNA Sequence

GAAGGATCGTCTCGTTTCTGATAGGGCAATTTAGCTTGCTGTGGATTGACCAGCAGAAGAGGCTAAATTTCAACGTTGATGTGGTGGAGAGTGATTGGGGACAAGGTGCTAATCTCCAAGTCTTGGCCTCAAAGCTCTCACAGGACCAAAATCATTCCATCAAAGCCATTTGCATTGTCCACAACGAGACCGCGACTGGAGTCACTAATGACATCTCTGCTGTCCGAACCCTCCTCGATCACTACAAGCACCCGGCTTTGCTGCTTGTGGACGGTGTCTCGTCCATATGTGCGCTTGATTTCCGAATGGATGAGTGGGGAGTGGATGTGGCCTTGACCGGATCTCAGAAGGCTTTATCTCTTCCAACAGGACTTGGTATTGTGTGCGCCAGTCCAAAAGCTTTGGAAGCTACCAAAACCTCAAAATCCCTCAAAGTCTTCTTTGATTGGAATGACTACCTCAAGTTTTACAAGCTCGGTACATATTGGCCATACACACCTTCCATTCAACTCCTTTACGGTCTTAGAGCTGCTCTTGATCTTATCTTTGAAGAAGGACTTGATAATGTCATCGCCCGTCATGCCCGTTTGGGAAAGGCCACAAGGCTCGCGGTGGAAGCGTGGGGGCTGAAAAACTGTACACAGAAGGAGGAGTGGATAAGTAACACAGTGACAGCGGTCATGGTGCCGCCAAATATAGACAGTACTGAGATTGTGAAAAGGGCGTGGAAGAGGTACAACCTTAGTCTTGGTCTTGGTCTCAACAAAGTGGCTGGCAAGGTTTTCAGAATTGGGCACCTTGGACATCTTAATGAGTTGCAACTTCTTGGGTGTTTGGCTGGAGTGGAGATGATACTCAAGGATGTTGGCTACCCAGTTGTATTGGGAAGTGGAGTTGCCGCTGCTTCTACTTATCTTCAGCAC


Protein sequences

Name Description Sequence
Bra.2386 translated coding region predicted by ESTScan from UniGene Bra.2386

XRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQGANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYPVVLGSGVAAASTYLQH

Domains

Domain Start-End Description Sequence

superfamily: SSF53383
IPR015424
2-293 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

RIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQGANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYPV

Gene3D: G3DSA:3.40.640.10
IPR015421
2-173 no description
Pyridoxal phosphate-dependent transferase, major r

RIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQGANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLY

HMMPanther: PTHR21152:SF7
2-308 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

RIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQGANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYPVVLGSGVAAASTYLQH

HMMPanther: PTHR21152
2-308 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

RIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQGANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYPVVLGSGVAAASTYLQH

HMMPfam: PF00266
IPR000192
14-244 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

LWIDQQKRLNFNVDVVESDWGQGANLQVLASKLSQDQNHSIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPNIDSTEIVKRAWK

PatternScan: PS00595
IPR020578
108-128 AA_TRANSFER_CLASS_5
Aminotransferase class-V pyridoxal-phosphate bindi

VDVALTGSQKALSLPTGLGIV

Gene3D: G3DSA:3.90.1150.10
IPR015422
174-299 no description
Pyridoxal phosphate-dependent transferase, major r

GLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPNIDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYPVVLGSGV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox