PRGDB00079406 (Bra.15379)

From PRG Wiki
Jump to: navigation, search
Bra.15379
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 633029 (D30049)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Poa pratensis

Comment?

Brassica rapa mRNA for S-receptor kinase SRK9, partial cds

DNA Sequence

AAGGTGTACGAAACATCTATCACCATTCTTACACCTTCTTGCTCGTCTTCTTTGTCATGATTTTATTTCGCCCTGCCTTTTCGCTCAGCACTTTGTCGTCTACAGAATCTCTTACAATCTCAAGCAACAGAACACTTGTATCTCCCGGTAATATCTTCGAGCTCGGCTTCTTCAGAACCAATTCTCGTTGGTATCTCGGGATGTGGTACAAGAAATTGTCCGGCAGAACCTATGTATGGGTTGCCAACCGAGATAACCCTCTCTCCAATTCCATTGGAACCCTCAAAATCTCCAACATGAACCTTGTCCTCCTCGATCACTCTAATAAATCTGTTTGGTCGACCAATCTTACTAGAGAAAATGTGAGATCTCCGGTGGTGGCAGAGCTTCTGGCTAACGGAAACTTCGTGGTACGAGACCCAAGTGGATTCTTGTGGCAAAGTTTCGATTACCCTACAGATACTTTGCTTCCAGAGATGAAACTGGGTTACGACCTCAAAACAGGGCTGAACAGGTTCCTTGTCTCATGGAGAAGTTCAGATGATCCGTCAAGCGGGGATTTCTCGTATAAACTCGACATTCAAAGGGGGTTGCCTGAGTTCTATACATTTAAAGACAACACTCTAGTGCATCGGACTGGTCCATGGAATGGAATCCGATTTAGTGGCATACCAGAGGAACAACAGTTGAGTTACATGGTTTACAATTTCACAGAGAATAGTGAGGAGGTCGCTTATACATTTCTAGTGACCAACAACAGCATCTACTCAAGATTGACAATAAATTTCTCAGGGTTTTTTGAGCGACTGACATGGACTCCGTCATTAGTGATATGGAACCCAATCTGGTCTTCTCCAGCGAGCTTCCAGTGCGATCCGTACATGATTTGTGGGCCTGGCTCTTACTGTGACGTGAACACATTACCGTTGTGTAATTGTATCCAAGGGTTCAAGCCCTTGAATGTGCAAGAGTGGGATATGAGAGATCACACACGTGGTTGTATAAGGAGGACGCGGCTGAGCTGCAGAGGAGATGGTTTTACCAGGATGAAGAATATGAAGTTGCCAGAAACTACGATGGCTACTGTCGACCGCAGTATTGGTGTGAAAGAATGTGAGAAGAAGTGCCTTAGCGACTGTAATTGTACCGCGTTTGCAAATGCGGATATCCGGGATGGTGGGACGGGTTGTGTGATTTGGACCGGACGGCTTGACGATATGCGGAATTATGCTGTCAGTGGTCAAGATCTTTATGTCAGATTGGCTGCTGCTGATGTCGTTGAGAAGAGAACCGCGAATGGGAAAATCGTAAGTTTGATTGTTGGAGTCTGTGTTCTGCTTCTTCTTATATTTTTCTGCCTCTGGAAAAGGAAACAAAGGCGAGCAAAAGCAATGGCAACATCTATTGTCCATCGACAGAGAAAACAAATTTTGCTTATGAACGGGATGACACTATCAAACAATAGACAGTTGTCTAGAGAGAACAAAACTGGGGAATTCGAACTTCCATTGATAGAGTTGGAAGCTGTTGTCAAATCCACCGAAAACTTTTCCAATTGTAACAAACTCGGGCAAGGTGGTTTTGGGATTGTTTACAAGGGTACGCTCGACGGGCAAGAAATTGCAGTAAAAAGGCTATCAAAGACGTCAGTTCAGGGGGCTGATGAGTTTATGAATGAGGTGACATTAATCGCTAGGCTTCAGCATATAAACCTTGTCCAAATTCTGGGATGTTGCATTGACGCAGATGAGAAGATGCTCATATATGAGTATTTGGAAAATTTAAGCCTCGATTCTTATCTCTTTGGAAAAACCCGAAGCTCTAAGCTAAATTGGAAGGAGAGATTCGACATTACCAATGGGATTGCTCGAGGGCTTTTATATCTTCATCAAGACTCACGGTTTAGGATAATCCACAGAGATTTGAAAGTAAGTAACATTTTGCTTGATAAAAATATGATCCCAAAGATCTCGGATTTTGGGATGGCCAGGATATTTGCACGGGACGAGACGGAAGCTAACACAATGAGGGTGGTCGGAACTTACGGCTACATGTCCCCGGAGTATGCAATGGAGGGAATATTCTCGGAAAAATCAGATGTTTTCAGTTTTGGAGTAATAGTTCTTGAAATTGTTACTGGAAAGAGGAACAGAGAATTCAACAACGAAAACAATCTTCTAAGCTATGCATGGAGTAATTGGAAGGAAGGAAGAGCGCTAGAAATCGTAGATCCAGATATCGTAGATTCACTTTCACCACTGTCATCAACATTTCAACCACAAGAAGTCCTAAAATGCATACAAATTGGTCTCTTGTGTGTTCAAGAACTTGCAGAACACAGACCAACAATGTCGTCTGTGGTTTGGATGCTTGGAAGTGAAGCAACAGAGATTCCTCAGCCTAAACCACCAGGTTATTGGGTCCGAAGAAGTTCTTATGAACTTGATCCTTCATCAAGTAAGTGCGACGATGATTCCTGGACGGTGAACCAGTACACCTGCTCAGTCATAGATGCCCGCTAATATGGAATCTATTAAGAAAGTTCATATAAATAAACATTACTAAATGCCGTGACTCAATATCACATGTGAAAGAAGGAAAATAAATTCTTAATAGTTAAGTATGTTATTTTGATAACAAATTCTTGTTTTTTCTAGCTGTATCTATCTTATTAAAATATAATTACACTTAT


Protein sequences

Name Description Sequence
Bra.15379 translated coding region predicted by ESTScan from UniGene Bra.15379

XGVRNIYHHSYTFLLVFFVMILFRPAFSLSTLSSTESLTISSNRTLVSPGNIFELGFFRTNSRWYLGMWYKKLSGRTYVWVANRDNPLSNSIGTLKISNMNLVLLDHSNKSVWSTNLTRENVRSPVVAELLANGNFVVRDPSGFLWQSFDYPTDTLLPEMKLGYDLKTGLNRFLVSWRSSDDPSSGDFSYKLDIQRGLPEFYTFKDNTLVHRTGPWNGIRFSGIPEEQQLSYMVYNFTENSEEVAYTFLVTNNSIYSRLTINFSGFFERLTWTPSLVIWNPIWSSPASFQCDPYMICGPGSYCDVNTLPLCNCIQGFKPLNVQEWDMRDHTRGCIRRTRLSCRGDGFTRMKNMKLPETTMATVDRSIGVKECEKKCLSDCNCTAFANADIRDGGTGCVIWTGRLDDMRNYAVSGQDLYVRLAAADVVEKRTANGKIVSLIVGVCVLLLLIFFCLWKRKQRRAKAMATSIVHRQRKQILLMNGMTLSNNRQLSRENKTGEFELPLIELEAVVKSTENFSNCNKLGQGGFGIVYKGTLDGQEIAVKRLSKTSVQGADEFMNEVTLIARLQHINLVQILGCCIDADEKMLIYEYLENLSLDSYLFGKTRSSKLNWKERFDITNGIARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEANTMRVVGTYGYMSPEYAMEGIFSEKSDVFSFGVIVLEIVTGKRNREFNNENNLLSYAWSNWKEGRALEIVDPDIVDSLSPLSSTFQPQEVLKCIQIGLLCVQELAEHRPTMSSVVWMLGSEATEIPQPKPPGYWVRRSSYELDPSSSKCDDDSWTVNQYTCSVIDAR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF432
1-840 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

XGVRNIYHHSYTFLLVFFVMILFRPAFSLSTLSSTESLTISSNRTLVSPGNIFELGFFRTNSRWYLGMWYKKLSGRTYVWVANRDNPLSNSIGTLKISNMNLVLLDHSNKSVWSTNLTRENVRSPVVAELLANGNFVVRDPSGFLWQSFDYPTDTLLPEMKLGYDLKTGLNRFLVSWRSSDDPSSGDFSYKLDIQRGLPEFYTFKDNTLVHRTGPWNGIRFSGIPEEQQLSYMVYNFTENSEEVAYTFLVTNNSIYSRLTINFSGFFERLTWTPSLVIWNPIWSSPASFQCDPYMICGPGSYCDVNTLPLCNCIQGFKPLNVQEWDMRDHTRGCIRRTRLSCRGDGFTRMKNMKLPETTMATVDRSIGVKECEKKCLSDCNCTAFANADIRDGGTGCVIWTGRLDDMRNYAVSGQDLYVRLAAADVVEKRTANGKIVSLIVGVCVLLLLIFFCLWKRKQRRAKAMATSIVHRQRKQILLMNGMTLSNNRQLSRENKTGEFELPLIELEAVVKSTENFSNCNKLGQGGFGIVYKGTLDGQEIAVKRLSKTSVQGADEFMNEVTLIARLQHINLVQILGCCIDADEKMLIYEYLENLSLDSYLFGKTRSSKLNWKERFDITNGIARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEANTMRVVGTYGYMSPEYAMEGIFSEKSDVFSFGVIVLEIVTGKRNREFNNENNLLSYAWSNWKEGRALEIVDPDIVDSLSPLSSTFQPQEVLKCIQIGLLCVQELAEHRPTMSSVVWMLGSEATEIPQPKPPGYWVRRSSYELDPSSSKCDDDSWTVNQYTCSVIDAR

HMMPanther: PTHR24420
1-840 FAMILY NOT NAMED,FAMILY NOT NAMED

XGVRNIYHHSYTFLLVFFVMILFRPAFSLSTLSSTESLTISSNRTLVSPGNIFELGFFRTNSRWYLGMWYKKLSGRTYVWVANRDNPLSNSIGTLKISNMNLVLLDHSNKSVWSTNLTRENVRSPVVAELLANGNFVVRDPSGFLWQSFDYPTDTLLPEMKLGYDLKTGLNRFLVSWRSSDDPSSGDFSYKLDIQRGLPEFYTFKDNTLVHRTGPWNGIRFSGIPEEQQLSYMVYNFTENSEEVAYTFLVTNNSIYSRLTINFSGFFERLTWTPSLVIWNPIWSSPASFQCDPYMICGPGSYCDVNTLPLCNCIQGFKPLNVQEWDMRDHTRGCIRRTRLSCRGDGFTRMKNMKLPETTMATVDRSIGVKECEKKCLSDCNCTAFANADIRDGGTGCVIWTGRLDDMRNYAVSGQDLYVRLAAADVVEKRTANGKIVSLIVGVCVLLLLIFFCLWKRKQRRAKAMATSIVHRQRKQILLMNGMTLSNNRQLSRENKTGEFELPLIELEAVVKSTENFSNCNKLGQGGFGIVYKGTLDGQEIAVKRLSKTSVQGADEFMNEVTLIARLQHINLVQILGCCIDADEKMLIYEYLENLSLDSYLFGKTRSSKLNWKERFDITNGIARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEANTMRVVGTYGYMSPEYAMEGIFSEKSDVFSFGVIVLEIVTGKRNREFNNENNLLSYAWSNWKEGRALEIVDPDIVDSLSPLSSTFQPQEVLKCIQIGLLCVQELAEHRPTMSSVVWMLGSEATEIPQPKPPGYWVRRSSYELDPSSSKCDDDSWTVNQYTCSVIDAR

Seg: seg
28-42 seg

SLSTLSSTESLTISS

ProfileScan: PS50927
IPR001480
31-151 BULB_LECTIN
Bulb-type lectin domain

TLSSTESLTISSNRTLVSPGNIFELGFFRTNSRWYLGMWYKKLSGRTYVWVANRDNPLSNSIGTLKISNMNLVLLDHSNKSVWSTNLTRENVRSPVVAELLANGNFVVRDPSGFLWQSFDY

HMMSmart: SM00108
IPR001480
37-152 Bulb-type mannose-specific lectin
Bulb-type lectin domain

SLTISSNRTLVSPGNIFELGFFRTNSRWYLGMWYKKLSGRTYVWVANRDNPLSNSIGTLKISNMNLVLLDHSNKSVWSTNLTRENVRSPVVAELLANGNFVVRDPSGFLWQSFDYP

superfamily: SSF51110
IPR001480
66-183 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

LGMWYKKLSGRTYVWVANRDNPLSNSIGTLKISNMNLVLLDHSNKSVWSTNLTRENVRSPVVAELLANGNFVVRDPSGFLWQSFDYPTDTLLPEMKLGYDLKTGLNRFLVSWRSSDDP

HMMPfam: PF01453
IPR001480
76-184 B_lectin
Bulb-type lectin domain

RTYVWVANRDNPLSNSIGTLKISNMNLVLLDHSNKSVWSTNLTRENVRSPVVAELLANGNFVVRDPSGFLWQSFDYPTDTLLPEMKLGYDLKTGLNRFLVSWRSSDDPS

Gene3D: G3DSA:2.90.10.10
IPR001480
185-223 no description
Bulb-type lectin domain

SGDFSYKLDIQRGLPEFYTFKDNTLVHRTGPWNGIRFSG

HMMPfam: PF00954
IPR000858
211-320 S_locus_glycop
S-locus glycoprotein

HRTGPWNGIRFSGIPEEQQLSYMVYNFTENSEEVAYTFLVTNNSIYSRLTINFSGFFERLTWTPSLVIWNPIWSSPASFQCDPYMICGPGSYCDVNTLPLCNCIQGFKPL

HMMPfam: PF08276
IPR013227
342-407 PAN_2
PAN-2 domain

CRGDGFTRMKNMKLPETTMATVDRSIGVKECEKKCLSDCNCTAFANADIRDGGTGCVIWTGRLDDM

ProfileScan: PS50948
IPR003609
342-422 PAN
Apple-like

CRGDGFTRMKNMKLPETTMATVDRSIGVKECEKKCLSDCNCTAFANADIRDGGTGCVIWTGRLDDMRNYAVSGQDLYVRLA

HMMSmart: SM00473
IPR003609
342-421 divergent subfamily of APPLE domains
Apple-like

CRGDGFTRMKNMKLPETTMATVDRSIGVKECEKKCLSDCNCTAFANADIRDGGTGCVIWTGRLDDMRNYAVSGQDLYVRL

Seg: seg
439-454 seg

LIVGVCVLLLLIFFCL

HMMPfam: PF12398
IPR022126
466-507 DUF3660
S-locus, receptor kinase

ATSIVHRQRKQILLMNGMTLSNNRQLSRENKTGEFELPLIEL

superfamily: SSF56112
IPR011009
487-791 Protein kinase-like (PK-like)
Protein kinase-like domain

NNRQLSRENKTGEFELPLIELEAVVKSTENFSNCNKLGQGGFGIVYKGTLDGQEIAVKRLSKTSVQGADEFMNEVTLIARLQHINLVQILGCCIDADEKMLIYEYLENLSLDSYLFGKTRSSKLNWKERFDITNGIARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEANTMRVVGTYGYMSPEYAMEGIFSEKSDVFSFGVIVLEIVTGKRNREFNNENNLLSYAWSNWKEGRALEIVDPDIVDSLSPLSSTFQPQEVLKCIQIGLLCVQELAEHRPTMSSVVWML

Gene3D: G3DSA:3.30.200.20
502-577 no description

LPLIELEAVVKSTENFSNCNKLGQGGFGIVYKGTLDGQEIAVKRLSKTSVQGADEFMNEVTLIARLQHINLVQILG

ProfileScan: PS50011
IPR000719
517-796 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSNCNKLGQGGFGIVYKGTLDGQEIAVKRLSKTSVQGADEFMNEVTLIARLQHINLVQILGCCIDADEKMLIYEYLENLSLDSYLFGKTRSSKLNWKERFDITNGIARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEANTMRVVGTYGYMSPEYAMEGIFSEKSDVFSFGVIVLEIVTGKRNREFNNENNLLSYAWSNWKEGRALEIVDPDIVDSLSPLSSTFQPQEVLKCIQIGLLCVQELAEHRPTMSSVVWMLGSEAT

HMMSmart: SM00219
IPR020635
517-791 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSNCNKLGQGGFGIVYKGTLDGQEIAVKRLSKTSVQGADEFMNEVTLIARLQHINLVQILGCCIDADEKMLIYEYLENLSLDSYLFGKTRSSKLNWKERFDITNGIARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEANTMRVVGTYGYMSPEYAMEGIFSEKSDVFSFGVIVLEIVTGKRNREFNNENNLLSYAWSNWKEGRALEIVDPDIVDSLSPLSSTFQPQEVLKCIQIGLLCVQELAEHRPTMSSVVWML

HMMSmart: SM00220
IPR002290
517-791 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSNCNKLGQGGFGIVYKGTLDGQEIAVKRLSKTSVQGADEFMNEVTLIARLQHINLVQILGCCIDADEKMLIYEYLENLSLDSYLFGKTRSSKLNWKERFDITNGIARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEANTMRVVGTYGYMSPEYAMEGIFSEKSDVFSFGVIVLEIVTGKRNREFNNENNLLSYAWSNWKEGRALEIVDPDIVDSLSPLSSTFQPQEVLKCIQIGLLCVQELAEHRPTMSSVVWML

HMMPfam: PF07714
IPR001245
520-789 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

CNKLGQGGFGIVYKGTLDGQEIAVKRLSKTSVQGADEFMNEVTLIARLQHINLVQILGCCIDADEKMLIYEYLENLSLDSYLFGKTRSSKLNWKERFDITNGIARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEANTMRVVGTYGYMSPEYAMEGIFSEKSDVFSFGVIVLEIVTGKRNREFNNENNLLSYAWSNWKEGRALEIVDPDIVDSLSPLSSTFQPQEVLKCIQIGLLCVQELAEHRPTMSSVVW

PatternScan: PS00107
IPR017441
523-544 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGGFGIVYKGTLDGQEIAVK

Gene3D: G3DSA:1.10.510.10
578-788 no description

CCIDADEKMLIYEYLENLSLDSYLFGKTRSSKLNWKERFDITNGIARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEANTMRVVGTYGYMSPEYAMEGIFSEKSDVFSFGVIVLEIVTGKRNREFNNENNLLSYAWSNWKEGRALEIVDPDIVDSLSPLSSTFQPQEVLKCIQIGLLCVQELAEHRPTMSSVV

PatternScan: PS00108
IPR008271
637-649 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKVSNILL

Seg: seg
716-727 seg

RNREFNNENNLL

HMMPfam: PF11883
IPR021820
793-840 DUF3403
S-locus receptor kinase, C-terminal

SEATEIPQPKPPGYWVRRSSYELDPSSSKCDDDSWTVNQYTCSVIDAR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox