PRGDB00079410 (Bra.15421)

From PRG Wiki
Jump to: navigation, search
Bra.15421
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 83596100 (DQ294652)
Gene Class Unknown
Domain Type LRR
Gene Species Poa pratensis

Comment?

Brassica rapa subsp. chinensis clone MF4 pollen development related protein mRNA, complete cds

DNA Sequence

AAACACACCATGGATAAGATAACGACTACATTGCTCTTTTCCTTGTTCGCTCTCCTCCTCACGGCCTCTTTGTCAAAAGATCTCTGTCACAAAGATGACGAAAACGCCCTCCTCAAGATCAAGAAGTCCCTTAACAACCCTTACACCATCATTTCCTGGGACCCCAAAGACGACTGCTGCACCTGGGTCTCCGTTGAGTGCGGCGACGCAACTGTTGATCACCGCGTCATCTCCCTAGACATATCAAACGACGATGTCTCCGCTCAGATCCCTCCTGAAGTCGGCGACTTATCGTATCTACAAACCCTCATATTCCGCAAACTCCCTAACCTCACCGGTGAAATCAAACCTACCATCGCCAAGCTCAAGTATCTTCGTTTTCTCTGGCTCAGCTGGACCAACCTGACCGGTCCGGTTCCTGAATTTTTGAGTCAGCTCAAGGATCTAGAGTACATTAACCTTTCCTTCAATGACCTCTCTGGTTCCATACCCGGTTCTCTCTCTTTGTTACCTAAACTCGGGATTCTTGAACTAAGCAGGAACAAACTTACAGGTTCAATACCAGAGTCATTTGGAGCGTTTAAAGGAGTGGTACCTCCTGAGCTTTTTCTATCGCACAACCAGCTATCCGGTTCGATACCAAAATCACTAGGAAACCTCGATTTTCACCGGATCGATTTCTCCCATAACAAGCTTGAAGGTGATGCTTCGATGATGTTTGGAGCCAAAAAGACGTCATGGTCCGTTGATTTATCAAGAAACAAGCTCCAGTTTGATATTTCCAAGGTTAAAGTGGCTACAACAGTTAATAACTTAGACTTGAATCACAATAAGATCACAGGGAGTATCCCGGTTCAATGGACCGAGCTTACTCTTCAGTCTTTCAATGTAAGTTATAACCGACTTTGTGGACGAATACCCCAGGGAGGGGACCTTCAGATATTTGATGCTTATGAGTATTTACACAACAAGTGTTTGTGTGATGCACCTCTTCAGAGTTGCAAGTGAGCTTACCAAGCGTTTATCTATAAACTTACCACAAGTATCAATGAAGTCTAAGGACAACTGTATTTTCCATTGGGAATAAATAATAAAAACTTAAGCACATTTGCGTTTGACaaaaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Bra.15421 translated coding region predicted by ESTScan from UniGene Bra.15421

KHTMDKITTTLLFSLFALLLTASLSKDLCHKDDENALLKIKKSLNNPYTIISWDPKDDCCTWVSVECGDATVDHRVISLDISNDDVSAQIPPEVGDLSYLQTLIFRKLPNLTGEIKPTIAKLKYLRFLWLSWTNLTGPVPEFLSQLKDLEYINLSFNDLSGSIPGSLSLLPKLGILELSRNKLTGSIPESFGAFKGVVPPELFLSHNQLSGSIPKSLGNLDFHRIDFSHNKLEGDASMMFGAKKTSWSVDLSRNKLQFDISKVKVATTVNNLDLNHNKITGSIPVQWTELTLQSFNVSYNRLCGRIPQGGDLQIFDAYEYLHNKCLCDAPLQSCKXAYQAFIYKLTTSINEV


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF915
4-352 PGIP2 (POLYGALACTURONASE INHIBITING PROTEIN 2); PROTEIN BINDING

MDKITTTLLFSLFALLLTASLSKDLCHKDDENALLKIKKSLNNPYTIISWDPKDDCCTWVSVECGDATVDHRVISLDISNDDVSAQIPPEVGDLSYLQTLIFRKLPNLTGEIKPTIAKLKYLRFLWLSWTNLTGPVPEFLSQLKDLEYINLSFNDLSGSIPGSLSLLPKLGILELSRNKLTGSIPESFGAFKGVVPPELFLSHNQLSGSIPKSLGNLDFHRIDFSHNKLEGDASMMFGAKKTSWSVDLSRNKLQFDISKVKVATTVNNLDLNHNKITGSIPVQWTELTLQSFNVSYNRLCGRIPQGGDLQIFDAYEYLHNKCLCDAPLQSCKXAYQAFIYKLTTSINEV

HMMPanther: PTHR24420
4-352 FAMILY NOT NAMED,FAMILY NOT NAMED

MDKITTTLLFSLFALLLTASLSKDLCHKDDENALLKIKKSLNNPYTIISWDPKDDCCTWVSVECGDATVDHRVISLDISNDDVSAQIPPEVGDLSYLQTLIFRKLPNLTGEIKPTIAKLKYLRFLWLSWTNLTGPVPEFLSQLKDLEYINLSFNDLSGSIPGSLSLLPKLGILELSRNKLTGSIPESFGAFKGVVPPELFLSHNQLSGSIPKSLGNLDFHRIDFSHNKLEGDASMMFGAKKTSWSVDLSRNKLQFDISKVKVATTVNNLDLNHNKITGSIPVQWTELTLQSFNVSYNRLCGRIPQGGDLQIFDAYEYLHNKCLCDAPLQSCKXAYQAFIYKLTTSINEV

Seg: seg
8-25 seg

TTTLLFSLFALLLTASLS

superfamily: SSF52058
27-335 L domain-like,LRR

DLCHKDDENALLKIKKSLNNPYTIISWDPKDDCCTWVSVECGDATVDHRVISLDISNDDVSAQIPPEVGDLSYLQTLIFRKLPNLTGEIKPTIAKLKYLRFLWLSWTNLTGPVPEFLSQLKDLEYINLSFNDLSGSIPGSLSLLPKLGILELSRNKLTGSIPESFGAFKGVVPPELFLSHNQLSGSIPKSLGNLDFHRIDFSHNKLEGDASMMFGAKKTSWSVDLSRNKLQFDISKVKVATTVNNLDLNHNKITGSIPVQWTELTLQSFNVSYNRLCGRIPQGGDLQIFDAYEYLHNKCLCDAPLQSCK

Gene3D: G3DSA:3.80.10.10
29-333 no description

CHKDDENALLKIKKSLNNPYTIISWDPKDDCCTWVSVECGDATVDHRVISLDISNDDVSAQIPPEVGDLSYLQTLIFRKLPNLTGEIKPTIAKLKYLRFLWLSWTNLTGPVPEFLSQLKDLEYINLSFNDLSGSIPGSLSLLPKLGILELSRNKLTGSIPESFGAFKGVVPPELFLSHNQLSGSIPKSLGNLDFHRIDFSHNKLEGDASMMFGAKKTSWSVDLSRNKLQFDISKVKVATTVNNLDLNHNKITGSIPVQWTELTLQSFNVSYNRLCGRIPQGGDLQIFDAYEYLHNKCLCDAPLQS

HMMPfam: PF08263
IPR013210
30-67 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

HKDDENALLKIKKSLNNPYTIISWDPKDDCCTWVSVEC

HMMPfam: PF12799
124-160 LRR_4,Leucine Rich repeats (2 copies)

YLRFLWLSWTNLTGPVPEFLSQLKDLEYINLSFNDLS

Seg: seg
159-179 seg

LSGSIPGSLSLLPKLGILELS

HMMPfam: PF00560
IPR001611
201-220 LRR_1
Leucine-rich repeat

ELFLSHNQLSGSIPKSLGNL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox