PRGDB00079550 (Bra.31001)

From PRG Wiki
Jump to: navigation, search
Bra.31001
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 158853071 (AB298878)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Poa pratensis

Comment?

Brassica rapa SRK-36 mRNA for S-locus receptor kinase (kinase domain), partial cds

DNA Sequence

CAAGATCTTTATGTCAGATTAGCTGCTGCTGATCTCGTTAAGAGGAGAAACGCGAATGGGAAAATCATAAGTTTGATTATTGGAGTTAGTGTTCTGCTTCTTCTGATTATGGTCGGGCTCTGGAAAAGGAAACAAAAGCGAGCAAAAGCACGAGCAAAAGCACGAGCAATATTTATTGAAACAGCAAATCGGCAGAGAAACCAAAATTTGCCTATGAAGGGGATGGTACTATCAAACAAGAGGCAGTTGTCTGGAGAGAACAAAATTGAGGAAGTGGAACTTCCATTGATGGAGTTAGAAACTGTTGTCAAAGCCACCGAAAATTTCTCCAATTGTAACAAAATCGGACAAGGTGGTTTTGGTATTGTTTACAAGGGAATATTACTTGACGGGCAAGAAATCGCGGTAAAAAGACTATCAGAGACGTCATTTCAAGGGACTGATGAGTTTATGAATGAGGTGACATTAATCGCAAGGCTTCAGCATATAAACCTTGTTCAAGTTCTTGGCTGTTGCATTGAAGGAGATGAGAAAATGCTGATATATGAGTATTTGGAAAATTTAAGCCTCGATTCCTATCTCTTCGGAAAAACCCGAAGCTCTAAGCTAAGTTGGAAGGATAGATTCGACATTATCAATGGTGTTGCTAGAGGGCTTTTATATCTTCATCAAGACTCACGGTTTAGGATAATCCACAGAGATTTGAAAGCAAGTAACATTTTGCTTGATAAAAATATGATCCCAAAGATCTCAGATTTTGGGATGGCCAGAATCTTTGCACGGGACGAGACTGAAGCTAACACAAGGAAGGTGGTCGGAACTTACGGCTACATGTCCCCGGAGTATGCAATGTATGGGAAATTCTCGGAAAAATCCGATGTCTTCAGTTTTGGAGTCATAGTTCTTGAGATTGTTACTGGAAAGAGGAACAGAGGACTTCACAACTTGAACTACGAAAACAATCTTCTAAGCTATGCATGGAGTAATTGGAAGGAAGGAAGAGCGCTAGAAATCGTAGATCCAGTCATCATAGACTCATTGTCACCACTGTCATCAACACTTCAACCACAAGAAGTCCTAAGATGCATACAAATTGGTCTCTTGTGTGTTCAAGAACTTGCAGAGAACAGACCAACCATGTCGTCTGTGGTTTGGATGCTTGGAGGTGAAGCAACAGAGATTCCCCAGCCTAAACCGTCAGGTTATTGCGTCGGAAGAAGTCCTTATGAATTTGTTCTTTCATCAAGTACGCAATTCAACGACGATGAATCCTGGACGGTGAACCAATACACCTGCTCAGTCATCGATGCCCGG


Protein sequences

Name Description Sequence
Bra.31001 translated coding region predicted by ESTScan from UniGene Bra.31001

QDLYVRLAAADLVKRRNANGKIISLIIGVSVLLLLIMVGLWKRKQKRAKARAKARAIFIETANRQRNQNLPMKGMVLSNKRQLSGENKIEEVELPLMELETVVKATENFSNCNKIGQGGFGIVYKGILLDGQEIAVKRLSETSFQGTDEFMNEVTLIARLQHINLVQVLGCCIEGDEKMLIYEYLENLSLDSYLFGKTRSSKLSWKDRFDIINGVARGLLYLHQDSRFRIIHRDLKASNILLDKNMIPKISDFGMARIFARDETEANTRKVVGTYGYMSPEYAMYGKFSEKSDVFSFGVIVLEIVTGKRNRGLHNLNYENNLLSYAWSNWKEGRALEIVDPVIIDSLSPLSSTLQPQEVLRCIQIGLLCVQELAENRPTMSSVVWMLGGEATEIPQPKPSGYCVGRSPYEFVLSSSTQFNDDESWTVNQYTCSVIDAR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF432
14-434 PTHR24420:SF432,SUBFAMILY NOT NAMED

KRRNANGKIISLIIGVSVLLLLIMVGLWKRKQKRAKARAKARAIFIETANRQRNQNLPMKGMVLSNKRQLSGENKIEEVELPLMELETVVKATENFSNCNKIGQGGFGIVYKGILLDGQEIAVKRLSETSFQGTDEFMNEVTLIARLQHINLVQVLGCCIEGDEKMLIYEYLENLSLDSYLFGKTRSSKLSWKDRFDIINGVARGLLYLHQDSRFRIIHRDLKASNILLDKNMIPKISDFGMARIFARDETEANTRKVVGTYGYMSPEYAMYGKFSEKSDVFSFGVIVLEIVTGKRNRGLHNLNYENNLLSYAWSNWKEGRALEIVDPVIIDSLSPLSSTLQPQEVLRCIQIGLLCVQELAENRPTMSSVVWMLGGEATEIPQPKPSGYCVGRSPYEFVLSSSTQFNDDESWTVNQYTCSV

HMMPanther: PTHR24420
14-434 PTHR24420,FAMILY NOT NAMED

KRRNANGKIISLIIGVSVLLLLIMVGLWKRKQKRAKARAKARAIFIETANRQRNQNLPMKGMVLSNKRQLSGENKIEEVELPLMELETVVKATENFSNCNKIGQGGFGIVYKGILLDGQEIAVKRLSETSFQGTDEFMNEVTLIARLQHINLVQVLGCCIEGDEKMLIYEYLENLSLDSYLFGKTRSSKLSWKDRFDIINGVARGLLYLHQDSRFRIIHRDLKASNILLDKNMIPKISDFGMARIFARDETEANTRKVVGTYGYMSPEYAMYGKFSEKSDVFSFGVIVLEIVTGKRNRGLHNLNYENNLLSYAWSNWKEGRALEIVDPVIIDSLSPLSSTLQPQEVLRCIQIGLLCVQELAENRPTMSSVVWMLGGEATEIPQPKPSGYCVGRSPYEFVLSSSTQFNDDESWTVNQYTCSV

HMMPfam: PF12398
IPR022126
62-99 DUF3660
S-locus, receptor kinase

ANRQRNQNLPMKGMVLSNKRQLSGENKIEEVELPLMEL

superfamily: SSF56112
IPR011009
79-387 Kinase_like
Protein kinase-like domain

NKRQLSGENKIEEVELPLMELETVVKATENFSNCNKIGQGGFGIVYKGILLDGQEIAVKRLSETSFQGTDEFMNEVTLIARLQHINLVQVLGCCIEGDEKMLIYEYLENLSLDSYLFGKTRSSKLSWKDRFDIINGVARGLLYLHQDSRFRIIHRDLKASNILLDKNMIPKISDFGMARIFARDETEANTRKVVGTYGYMSPEYAMYGKFSEKSDVFSFGVIVLEIVTGKRNRGLHNLNYENNLLSYAWSNWKEGRALEIVDPVIIDSLSPLSSTLQPQEVLRCIQIGLLCVQELAENRPTMSSVVWML

Gene3D: G3DSA:3.30.200.20
92-170 G3DSA:3.30.200.20

VELPLMELETVVKATENFSNCNKIGQGGFGIVYKGILLDGQEIAVKRLSETSFQGTDEFMNEVTLIARLQHINLVQVLG

ProfileScan: PS50011
IPR000719
109-412 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSNCNKIGQGGFGIVYKGILLDGQEIAVKRLSETSFQGTDEFMNEVTLIARLQHINLVQVLGCCIEGDEKMLIYEYLENLSLDSYLFGKTRSSKLSWKDRFDIINGVARGLLYLHQDSRFRIIHRDLKASNILLDKNMIPKISDFGMARIFARDETEANTRKVVGTYGYMSPEYAMYGKFSEKSDVFSFGVIVLEIVTGKRNRGLHNLNYENNLLSYAWSNWKEGRALEIVDPVIIDSLSPLSSTLQPQEVLRCIQIGLLCVQELAENRPTMSSVVWMLGGEATEIPQPKPSGYCVGRSPYEFV

HMMPfam: PF07714
IPR001245
112-385 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

CNKIGQGGFGIVYKGILLDGQEIAVKRLSETSFQGTDEFMNEVTLIARLQHINLVQVLGCCIEGDEKMLIYEYLENLSLDSYLFGKTRSSKLSWKDRFDIINGVARGLLYLHQDSRFRIIHRDLKASNILLDKNMIPKISDFGMARIFARDETEANTRKVVGTYGYMSPEYAMYGKFSEKSDVFSFGVIVLEIVTGKRNRGLHNLNYENNLLSYAWSNWKEGRALEIVDPVIIDSLSPLSSTLQPQEVLRCIQIGLLCVQELAENRPTMSSVVW

PatternScan: PS00107
IPR017441
115-137 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGQGGFGIVYKGILLDGQEIAVK

Gene3D: G3DSA:1.10.510.10
171-310 G3DSA:1.10.510.10

CCIEGDEKMLIYEYLENLSLDSYLFGKTRSSKLSWKDRFDIINGVARGLLYLHQDSRFRIIHRDLKASNILLDKNMIPKISDFGMARIFARDETEANTRKVVGTYGYMSPEYAMYGKFSEKSDVFSFGVIVLEIVTGKRN

PatternScan: PS00108
IPR008271
230-242 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKASNILL

HMMPfam: PF11883
IPR021820
390-438 DUF3403
S-locus receptor kinase, C-terminal

EATEIPQPKPSGYCVGRSPYEFVLSSSTQFNDDESWTVNQYTCSVIDAR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox