PRGDB00079574 (Cpo.1069)

From PRG Wiki
Jump to: navigation, search
Cpo.1069
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 48572904 (CO035128)
Gene Class Unknown
Domain Type
Gene Species Triticum turgidum subsp. dicoccoides

Comment?

EST813512 Coccidioides posadasii spherule cDNA library, 0.5 to 5.3 kb Coccidioides posadasii cDNA clone CIFBY20 5' end, mRNA sequence

DNA Sequence

CTGCCTGAACACCCCCTTCTCGACCGAGAGAGCTGTCTCTGTCGAACCCGACGACCTAGAATATAAACCCATTCTTCGAGAAGCCCCTCCTCGCCATCAACTTCAGCAACTCCCGCAGCAGCAACAGCGAAACTATAGCACCACGACCGGGAATAGCGCCTCTGCAACCATGTCTGCCCAAGCTCCTCACCCTACCCTGCTCATCCCGGGCCCGATTGAGTTTGACGATGCCGTCCTTCAGTCCATGTCTCATTTCGCCGAGAGCCATGTCGGCCCAGCATTCGTCAAGACCTTTGGTGAATCCTTGACCCTTGTCCGCAAGCTCTTCCAAAGCACCTCTCCCACCGCCCAGCCCTTCATCCTCGCGGGCTCCGGCACCCTTGGCTGGGACCTCGTTGCGTCAAACCTCATCGAGGCCGGCCAGGAAGCCCTCGTCCTCCACAGCGGTTACTTTGCCGACTCCTTCGCTGCCTGTCTCGAAACCTACGGCGCCAAGGCCACCCAGCTGAAAGCTCCCATCGGGGACCGGCCATCCCTGTCAGACATTGAACAGGCATTGAAACTCGCCGATTACAAAGTCATCACCATCACCCACGTCGACACCTCCACCGGTGTCCTCAGCGATATCAAGGCCGTCGCTGAACTCGTCAGACGTGTGAGCCCCAACACCCTCGTTGTCGTCGACGGTGTCTGCAGCGTCGGGTGCGAAGAAATCGCCTTTGACGAATGGGACATCGACGTCGTCCTAACCGCCAGCCAAAAGGCCATCGGCTGTCCTCCCGGCCTCAGCATCGTGATGTGCTCCGGCCGTGCCATGGAGAGGTTCAAGACCCGCCAGAGCCCACCGGCTAGCTACTACGCTTCGATGGTCAACTGGCTTCCCGTCATGCAAAACTACGAGGGCGGGGCAGCGTCATACTTTGCCACTCCAGCTACCCAGCTCGTCAGGGCACTCCACACGTCCCTCGTCCAGATCGCATCTAAACCTCTCTCTGAGCGCTTTGCTGCTCAACGTGC


Protein sequences

Name Description Sequence
Cpo.1069 translated coding region predicted by ESTScan from UniGene Cpo.1069

XCLNTPFSTERAVSVEPDDLEYKPILREAPPRHQLQQLPQQQQRNYSTTTGNSASATMSAQAPHPTLLIPGPIEFDDAVLQSMSHFAESHVGPAFVKTFGESLTLVRKLFQSTSPTAQPFILAGSGTLGWDLVASNLIEAGQEALVLHSGYFADSFAACLETYGAKATQLKAPIGDRPSLSDIEQALKLADYKVITITHVDTSTGVLSDIKAVAELVRRVSPNTLVVVDGVCSVGCEEIAFDEWDIDVVLTASQKAIGCPPGLSIVMCSGRAMERFKTRQSPPASYYASMVNWLPVMQNYEGGAASYFATPATQLVRALHTSLVQIASKPLSERFAAQRA

Domains

Domain Start-End Description Sequence

Seg: seg
34-43 seg

QLQQLPQQQQ

HMMPanther: PTHR21152:SF7
54-340 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

ASATMSAQAPHPTLLIPGPIEFDDAVLQSMSHFAESHVGPAFVKTFGESLTLVRKLFQSTSPTAQPFILAGSGTLGWDLVASNLIEAGQEALVLHSGYFADSFAACLETYGAKATQLKAPIGDRPSLSDIEQALKLADYKVITITHVDTSTGVLSDIKAVAELVRRVSPNTLVVVDGVCSVGCEEIAFDEWDIDVVLTASQKAIGCPPGLSIVMCSGRAMERFKTRQSPPASYYASMVNWLPVMQNYEGGAASYFATPATQLVRALHTSLVQIASKPLSERFAAQRA

HMMPanther: PTHR21152
54-340 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

ASATMSAQAPHPTLLIPGPIEFDDAVLQSMSHFAESHVGPAFVKTFGESLTLVRKLFQSTSPTAQPFILAGSGTLGWDLVASNLIEAGQEALVLHSGYFADSFAACLETYGAKATQLKAPIGDRPSLSDIEQALKLADYKVITITHVDTSTGVLSDIKAVAELVRRVSPNTLVVVDGVCSVGCEEIAFDEWDIDVVLTASQKAIGCPPGLSIVMCSGRAMERFKTRQSPPASYYASMVNWLPVMQNYEGGAASYFATPATQLVRALHTSLVQIASKPLSERFAAQRA

superfamily: SSF53383
IPR015424
62-340 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

APHPTLLIPGPIEFDDAVLQSMSHFAESHVGPAFVKTFGESLTLVRKLFQSTSPTAQPFILAGSGTLGWDLVASNLIEAGQEALVLHSGYFADSFAACLETYGAKATQLKAPIGDRPSLSDIEQALKLADYKVITITHVDTSTGVLSDIKAVAELVRRVSPNTLVVVDGVCSVGCEEIAFDEWDIDVVLTASQKAIGCPPGLSIVMCSGRAMERFKTRQSPPASYYASMVNWLPVMQNYEGGAASYFATPATQLVRALHTSLVQIASKPLSERFAAQRA

HMMPfam: PF00266
IPR000192
70-280 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

PGPIEFDDAVLQSMSHFAESHVGPAFVKTFGESLTLVRKLFQSTSPTAQPFILAGSGTLGWDLVASNLIEAGQEALVLHSGYFADSFAACLETYGAKATQLKAPIGDRPSLSDIEQALKLADYKVITITHVDTSTGVLSDIKAVAELVRRVSPNTLVVVDGVCSVGCEEIAFDEWDIDVVLTASQKAIGCPPGLSIVMCSGRAMERFKTRQ

Gene3D: G3DSA:3.40.640.10
IPR015421
77-325 no description
Pyridoxal phosphate-dependent transferase, major r

DAVLQSMSHFAESHVGPAFVKTFGESLTLVRKLFQSTSPTAQPFILAGSGTLGWDLVASNLIEAGQEALVLHSGYFADSFAACLETYGAKATQLKAPIGDRPSLSDIEQALKLADYKVITITHVDTSTGVLSDIKAVAELVRRVSPNTLVVVDGVCSVGCEEIAFDEWDIDVVLTASQKAIGCPPGLSIVMCSGRAMERFKTRQSPPASYYASMVNWLPVMQNYEGGAASYFATPATQLVRALHTSLVQ

PatternScan: PS00595
IPR020578
246-266 AA_TRANSFER_CLASS_5
Aminotransferase class-V pyridoxal-phosphate bindi

IDVVLTASQKAIGCPPGLSIV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox