PRGDB00079575 (Cpo.1478)

From PRG Wiki
Jump to: navigation, search
Cpo.1478
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 219080860 (GH426166)
Gene Class Unknown
Domain Type
Gene Species Triticum turgidum subsp. dicoccoides

Comment?

G874P51RP16.T0 C. posadasii Silveira, 72HR SPHERULE_NORMALIZED Coccidioides posadasii cDNA, mRNA sequence

DNA Sequence

CCGAAAGCTTGCCGCTGCGGGTCAAGCGATCCTTTGCACCATTCATCAGCCGAATTCTGCACTGTTTGAGAACTTTGACCGTCTGCTATTGCTTCAACGAGGTGGCGAGTGTGTATATTTTGGTGATATTGGAACGGATGCACGCGTTCTCCGTGATTACTTCCACCGCAATGGTGCCGATTGCCCATCTAACGCGAACCCGGCTGAATGGATGCTTGATGCGATCGGTGCTGGACAGACACCACGGATTGGAAGCCGTTACTGGGGAGACGTTTGGAAGACATCTCCCGAATTTGAGCAAGTTAAACAACGGATTGTCGAAATCAAGGACGAGCGTGTCAAGGCAACTGAAGGGGCTTCCGCATCTGCGGATGCCGAGAAGGAATACGCCACCCCGATATGGCATCAGATCAAAGTTGTGTGTCGAAGGACCAACCTTGCGTTTTGGCGATCGCCAAACTATGGATTTACACGTCTTTTCAGCCATGTGGCACTTGCGTTGATCACTGGGCTGTGTTATCTCCAACTGAATGATTCTCGATCCTCTCTCCAGTACCGCATCTTCGTTCTCTTCCAAATTACAGTCATTCCGGCACTTATTCTCGCACAGGTTGAGCCAAAGTATGACATGTCTCGCTTGATTTTCTATCGTGAATCTGCCGCAAAAGCTTATAAACAATTCCCTTTCGCCCTGTCTATGGTCCTTGCGGAAGTTCCCTATAGTATCTCTGCGCAGTTGCTCATCATTCGCTTTACTATATCCAGATTGCAGTCGCTAGCAGCGGCC


Protein sequences

Name Description Sequence
Cpo.1478 translated coding region predicted by ESTScan from UniGene Cpo.1478

XRKLAAAGQAILCTIHQPNSALFENFDRLLLLQRGGECVYFGDIGTDARVLRDYFHRNGADCPSNANPAEWMLDAIGAGQTPRIGSRYWGDVWKTSPEFEQVKQRIVEIKDERVKATEGASASADAEKEYATPIWHQIKVVCRRTNLAFWRSPNYGFTRLFSHVALALITGLCYLQLNDSRSSLQYRIFVLFQITVIPALILAQVEPKYDMSRLIFYRESAAKAYKQFPFALSMVLAEVPYSISAQLLIIRFTISRLQSLAAA


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241:SF14
2-243 ATP-BINDING CASSETTE TRANSPORTER SUBFAMILY G,ATP-BINDING CASSETTE TRANSPORTER SUBFAMILY G

RKLAAAGQAILCTIHQPNSALFENFDRLLLLQRGGECVYFGDIGTDARVLRDYFHRNGADCPSNANPAEWMLDAIGAGQTPRIGSRYWGDVWKTSPEFEQVKQRIVEIKDERVKATEGASASADAEKEYATPIWHQIKVVCRRTNLAFWRSPNYGFTRLFSHVALALITGLCYLQLNDSRSSLQYRIFVLFQITVIPALILAQVEPKYDMSRLIFYRESAAKAYKQFPFALSMVLAEVPYSI

HMMPanther: PTHR19241
2-243 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

RKLAAAGQAILCTIHQPNSALFENFDRLLLLQRGGECVYFGDIGTDARVLRDYFHRNGADCPSNANPAEWMLDAIGAGQTPRIGSRYWGDVWKTSPEFEQVKQRIVEIKDERVKATEGASASADAEKEYATPIWHQIKVVCRRTNLAFWRSPNYGFTRLFSHVALALITGLCYLQLNDSRSSLQYRIFVLFQITVIPALILAQVEPKYDMSRLIFYRESAAKAYKQFPFALSMVLAEVPYSI

HMMPfam: PF01061
IPR013525
137-250 ABC2_membrane
ABC-2 type transporter

QIKVVCRRTNLAFWRSPNYGFTRLFSHVALALITGLCYLQLNDSRSSLQYRIFVLFQITVIPALILAQVEPKYDMSRLIFYRESAAKAYKQFPFALSMVLAEVPYSISAQLLII






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox