PRGDB00079577 (Cpo.1670)

From PRG Wiki
Jump to: navigation, search
Cpo.1670
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 48548350 (CO022872)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Triticum turgidum subsp. dicoccoides

Comment?

EST818965 Coccidioides posadasii saprobic phase cDNA library, greater than 4kb Coccidioides posadasii cDNA clone CIBCV57 3' end, mRNA sequence

DNA Sequence

ATTCGCAGACAGGTAACCATAGACGTATCGTAAGTAATTAAAGAGGGaaaaaaaaaTAAGAAATAAGAACAAAAGAGAAGTAAAGACGGAAAGGGCGGGCTGCAGGCAGAATTCCGGGTTTAGAGCTACTCTATGGGTAGGCCCAGTATCTAGGCAATAGATGGACCCAGGGTTGTGCATAGTGCTGTATCTACAAGTGTCCAATCTTCGCATGGAGTTCTGTATCCAAGAAGTTAAAGTTTGGATCGGGTATACAGAAGGGATGTTGGGAGAGGAGGGTTTCAGCGGTGGGACGGTCAAATGTATTAATCGTGAAGCAGTCGTACATAAAAGCTATAGCTGCTGGACAGATGTTCATCGACACATCTTCAGGGATAGGCGGCGCTTGGTTCAAGCTTCCAAGTTTGAAGATTGCCCCAATAGCCTCTTCTTTGCTCCATGGACGTCGACCAGCGAACATTTCCAAAACCACACACCCAAGAGACCAAATATCGACTTTGGCACTATATCCTTGGCCTTGGGACTGGACTACCTCTGGTGCCATCCAAAATACCGAGCCTTGCATTGAGTTGGTCACGTCGTTTCCGTAGATATTGTCGCTTTTCTTGGAGATACCAAAATCCGATATCTTGCAGGTTCCGTCGAGGTCAAGGAGGATATTGTCGGCCTTGAGATCTCGATGGAGAATGCCCTTGTCATGCAAGTAGGCCAGACCACGCAACGTCTGGATAGTAAGTGATTGAACCACACTTTCCTCAAACTTGCCGTGTTTCCGAAGACAACTTCCGATAGAGCCACCAGGTATATATTCGAGGTAAATGGACATGGACAATTCGCTTCGATGGCAACCGAGATATTGTACAATATTCGGGTGTTCCAATGCTGCATCGTGTCGATTTCATGGTCCATAGCCTGCACCATTTCTTTTATACGGTCTTTATCGTACCCGGCTGCTTTCTGGTTGACTTCCACTTTGTTCACCCGCCAGATCTC


Protein sequences

Name Description Sequence
Cpo.1670 translated coding region predicted by ESTScan from UniGene Cpo.1670

EIWRVNKVEVNQKAAGYDKDRIKEMVQAMDHEIDTMQHWNTRILYNISVAIEAELSMSIYLEYIPGGSIGSCLRKHGKFEESVVQSLTIQTLRGLAYLHDKGILHRDLKADNILLDLDGTCKISDFGISKKSDNIYGNDVTNSMQGSVFWMAPEVVQSQGQGYSAKVDIWSLGCVVLEMFAGRRPWSKEEAIGAIFKLGSLNQAPPIPEDVSMNICPAAIAFMYDCFTINTFDRPTAETLLSQHPFCIPDPNFNFLDTELHAKIGHL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24361:SF228
1-260 MAP KINASE KINASE KINASE MKH1

EIWRVNKVEVNQKAAGYDKDRIKEMVQAMDHEIDTMQHWNTRILYNISVAIEAELSMSIYLEYIPGGSIGSCLRKHGKFEESVVQSLTIQTLRGLAYLHDKGILHRDLKADNILLDLDGTCKISDFGISKKSDNIYGNDVTNSMQGSVFWMAPEVVQSQGQGYSAKVDIWSLGCVVLEMFAGRRPWSKEEAIGAIFKLGSLNQAPPIPEDVSMNICPAAIAFMYDCFTINTFDRPTAETLLSQHPFCIPDPNFNFLDTEL

HMMPanther: PTHR24361
1-260 FAMILY NOT NAMED,MITOGEN-ACTIVATED KINASE KINASE KINASE

EIWRVNKVEVNQKAAGYDKDRIKEMVQAMDHEIDTMQHWNTRILYNISVAIEAELSMSIYLEYIPGGSIGSCLRKHGKFEESVVQSLTIQTLRGLAYLHDKGILHRDLKADNILLDLDGTCKISDFGISKKSDNIYGNDVTNSMQGSVFWMAPEVVQSQGQGYSAKVDIWSLGCVVLEMFAGRRPWSKEEAIGAIFKLGSLNQAPPIPEDVSMNICPAAIAFMYDCFTINTFDRPTAETLLSQHPFCIPDPNFNFLDTEL

ProfileScan: PS50011
IPR000719
1-247 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

EIWRVNKVEVNQKAAGYDKDRIKEMVQAMDHEIDTMQHWNTRILYNISVAIEAELSMSIYLEYIPGGSIGSCLRKHGKFEESVVQSLTIQTLRGLAYLHDKGILHRDLKADNILLDLDGTCKISDFGISKKSDNIYGNDVTNSMQGSVFWMAPEVVQSQGQGYSAKVDIWSLGCVVLEMFAGRRPWSKEEAIGAIFKLGSLNQAPPIPEDVSMNICPAAIAFMYDCFTINTFDRPTAETLLSQHPFC

HMMSmart: SM00219
IPR020635
5-244 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

VNKVEVNQKAAGYDKDRIKEMVQAMDHEIDTMQHWNTRILYNISVAIEAELSMSIYLEYIPGGSIGSCLRKHGKFEESVVQSLTIQTLRGLAYLHDKGILHRDLKADNILLDLDGTCKISDFGISKKSDNIYGNDVTNSMQGSVFWMAPEVVQSQGQGYSAKVDIWSLGCVVLEMFAGRRPWSKEEAIGAIFKLGSLNQAPPIPEDVSMNICPAAIAFMYDCFTINTFDRPTAETLLSQH

HMMSmart: SM00220
IPR002290
8-247 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

VEVNQKAAGYDKDRIKEMVQAMDHEIDTMQHWNTRILYNISVAIEAELSMSIYLEYIPGGSIGSCLRKHGKFEESVVQSLTIQTLRGLAYLHDKGILHRDLKADNILLDLDGTCKISDFGISKKSDNIYGNDVTNSMQGSVFWMAPEVVQSQGQGYSAKVDIWSLGCVVLEMFAGRRPWSKEEAIGAIFKLGSLNQAPPIPEDVSMNICPAAIAFMYDCFTINTFDRPTAETLLSQHPFC

HMMPfam: PF00069
IPR017442
19-243 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

KDRIKEMVQAMDHEIDTMQHWNTRILYNISVAIEAELSMSIYLEYIPGGSIGSCLRKHGKFEESVVQSLTIQTLRGLAYLHDKGILHRDLKADNILLDLDGTCKISDFGISKKSDNIYGNDVTNSMQGSVFWMAPEVVQSQGQGYSAKVDIWSLGCVVLEMFAGRRPWSKEEAIGAIFKLGSLNQAPPIPEDVSMNICPAAIAFMYDCFTINTFDRPTAETLLSQ

superfamily: SSF56112
IPR011009
23-242 Protein kinase-like (PK-like)
Protein kinase-like domain

KEMVQAMDHEIDTMQHWNTRILYNISVAIEAELSMSIYLEYIPGGSIGSCLRKHGKFEESVVQSLTIQTLRGLAYLHDKGILHRDLKADNILLDLDGTCKISDFGISKKSDNIYGNDVTNSMQGSVFWMAPEVVQSQGQGYSAKVDIWSLGCVVLEMFAGRRPWSKEEAIGAIFKLGSLNQAPPIPEDVSMNICPAAIAFMYDCFTINTFDRPTAETLLS

Gene3D: G3DSA:3.30.200.20
23-80 no description

KEMVQAMDHEIDTMQHWNTRILYNISVAIEAELSMSIYLEYIPGGSIGSCLRKHGKFE

Gene3D: G3DSA:1.10.510.10
81-246 no description

ESVVQSLTIQTLRGLAYLHDKGILHRDLKADNILLDLDGTCKISDFGISKKSDNIYGNDVTNSMQGSVFWMAPEVVQSQGQGYSAKVDIWSLGCVVLEMFAGRRPWSKEEAIGAIFKLGSLNQAPPIPEDVSMNICPAAIAFMYDCFTINTFDRPTAETLLSQHPF

PatternScan: PS00108
IPR008271
103-115 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

ILHRDLKADNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox