PRGDB00079578 (Cpo.3232)

From PRG Wiki
Jump to: navigation, search
Cpo.3232
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 45931785 (CF825728)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Triticum turgidum subsp. dicoccoides

Comment?

EST703110 Coccidioides posadasii saprobic phase cDNA library, 2 to 4 kb Coccidioides posadasii cDNA clone CIDAY78 5' end, mRNA sequence

DNA Sequence

GGCGGACGCCTTCAAAGCCCGAACGCTAAAACGGAAGAATGTTAAAGGTCTCGCACTTAATGCCGCAGCATCGAAACTGGGATCAAAACCGTCCGATGGGGACGCACAAATCCCCGGAGCGATTGGGAATACTGACAGCAACCGCACGGACACCCTTGAGATTGGATTGGAGTTTCAACTTGATCTGCGGAGTGAAGACCTAATGGTCCTGAAGGAGCTTGGGGCTGGCAATGGAGGAACAGTTAGCAAAGTGATGCATGCTTCCACAAAAGTAATCATGGCTAGAAAAATCATCCGGGTTGATGCTAAAGAGAAGGTCAGAAAGCAAATATTGAGGGAGCTGCAAGTCGGCCGTCACTGTGACTCTCCTTATATCGTTACGTTCTATGGTGCGTTCACAAACGAGGCTCGGGATATTGTGCTGTGTATGGAGTACATGGATGGTGGTTCTCTCGATCGCATTTCGAAGGATTTTGGACCTGTTCGGGTTGATGTTCTAGGAAAGATCGCGGAGTCAATCTTCGCCGGCCTTGTCTATCTATACGAAGCACACCGTATCATGCATAGGGACATTAAGCCATCTAATGTTCTCGTTAATTCTAGAGGACATATTAAACTCTGCGACTTTGGCGTTGCAACGGAAACTGTCAACTCTGTGGCGGACACATTCGTTGGCACTTCGACCTACATGGCCCCTGAGCGGATTCAGGGGGAGGCCTACTCCGTGCGATCCGACGTATGGAGCGCCGGACTAACGATTATGGAACTAGCAGTTGGTCGTTTCCCATTTGACTCGTCAGATACAGCTGCCGGAGACAGGGCTAGTGCTGGCCCGATGGGCATTCTGGACCTGTTACAACAGATAGTCCATGAGCCCGCCCCAAAGCTTCCAAAAAGCGATGCCTTTCCCACGATTCTAGACGAATTTGTTGCTAAATGTTTGCTTAAGAAACAGGAGAACGACCAACTCCACGTGAACTTTTTGACCACGA


Protein sequences

Name Description Sequence
Cpo.3232 translated coding region predicted by ESTScan from UniGene Cpo.3232

XADAFKARTLKRKNVKGLALNAAASKLGSKPSDGDAQIPGAIGNTDSNRTDTLEIGLEFQLDLRSEDLMVLKELGAGNGGTVSKVMHASTKVIMARKIIRVDAKEKVRKQILRELQVGRHCDSPYIVTFYGAFTNEARDIVLCMEYMDGGSLDRISKDFGPVRVDVLGKIAESIFAGLVYLYEAHRIMHRDIKPSNVLVNSRGHIKLCDFGVATETVNSVADTFVGTSTYMAPERIQGEAYSVRSDVWSAGLTIMELAVGRFPFDSSDTAAGDRASAGPMGILDLLQQIVHEPAPKLPKSDAFPTILDEFVAKCLLKKQENDQLHVNFLTTX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24360:SF45
8-321 SUBFAMILY NOT NAMED

RTLKRKNVKGLALNAAASKLGSKPSDGDAQIPGAIGNTDSNRTDTLEIGLEFQLDLRSEDLMVLKELGAGNGGTVSKVMHASTKVIMARKIIRVDAKEKVRKQILRELQVGRHCDSPYIVTFYGAFTNEARDIVLCMEYMDGGSLDRISKDFGPVRVDVLGKIAESIFAGLVYLYEAHRIMHRDIKPSNVLVNSRGHIKLCDFGVATETVNSVADTFVGTSTYMAPERIQGEAYSVRSDVWSAGLTIMELAVGRFPFDSSDTAAGDRASAGPMGILDLLQQIVHEPAPKLPKSDAFPTILDEFVAKCLLKKQEN

HMMPanther: PTHR24360
8-321 FAMILY NOT NAMED,MAPKK/MEKK

RTLKRKNVKGLALNAAASKLGSKPSDGDAQIPGAIGNTDSNRTDTLEIGLEFQLDLRSEDLMVLKELGAGNGGTVSKVMHASTKVIMARKIIRVDAKEKVRKQILRELQVGRHCDSPYIVTFYGAFTNEARDIVLCMEYMDGGSLDRISKDFGPVRVDVLGKIAESIFAGLVYLYEAHRIMHRDIKPSNVLVNSRGHIKLCDFGVATETVNSVADTFVGTSTYMAPERIQGEAYSVRSDVWSAGLTIMELAVGRFPFDSSDTAAGDRASAGPMGILDLLQQIVHEPAPKLPKSDAFPTILDEFVAKCLLKKQEN

superfamily: SSF56112
IPR011009
50-321 Protein kinase-like (PK-like)
Protein kinase-like domain

TDTLEIGLEFQLDLRSEDLMVLKELGAGNGGTVSKVMHASTKVIMARKIIRVDAKEKVRKQILRELQVGRHCDSPYIVTFYGAFTNEARDIVLCMEYMDGGSLDRISKDFGPVRVDVLGKIAESIFAGLVYLYEAHRIMHRDIKPSNVLVNSRGHIKLCDFGVATETVNSVADTFVGTSTYMAPERIQGEAYSVRSDVWSAGLTIMELAVGRFPFDSSDTAAGDRASAGPMGILDLLQQIVHEPAPKLPKSDAFPTILDEFVAKCLLKKQEN

Gene3D: G3DSA:3.30.200.20
65-133 no description

SEDLMVLKELGAGNGGTVSKVMHASTKVIMARKIIRVDAKEKVRKQILRELQVGRHCDSPYIVTFYGAF

ProfileScan: PS50011
IPR000719
68-332 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LMVLKELGAGNGGTVSKVMHASTKVIMARKIIRVDAKEKVRKQILRELQVGRHCDSPYIVTFYGAFTNEARDIVLCMEYMDGGSLDRISKDFGPVRVDVLGKIAESIFAGLVYLYEAHRIMHRDIKPSNVLVNSRGHIKLCDFGVATETVNSVADTFVGTSTYMAPERIQGEAYSVRSDVWSAGLTIMELAVGRFPFDSSDTAAGDRASAGPMGILDLLQQIVHEPAPKLPKSDAFPTILDEFVAKCLLKKQENDQLHVNFLTTX

HMMSmart: SM00219
IPR020635
68-328 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LMVLKELGAGNGGTVSKVMHASTKVIMARKIIRVDAKEKVRKQILRELQVGRHCDSPYIVTFYGAFTNEARDIVLCMEYMDGGSLDRISKDFGPVRVDVLGKIAESIFAGLVYLYEAHRIMHRDIKPSNVLVNSRGHIKLCDFGVATETVNSVADTFVGTSTYMAPERIQGEAYSVRSDVWSAGLTIMELAVGRFPFDSSDTAAGDRASAGPMGILDLLQQIVHEPAPKLPKSDAFPTILDEFVAKCLLKKQENDQLHVNF

HMMSmart: SM00220
IPR002290
68-329 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LMVLKELGAGNGGTVSKVMHASTKVIMARKIIRVDAKEKVRKQILRELQVGRHCDSPYIVTFYGAFTNEARDIVLCMEYMDGGSLDRISKDFGPVRVDVLGKIAESIFAGLVYLYEAHRIMHRDIKPSNVLVNSRGHIKLCDFGVATETVNSVADTFVGTSTYMAPERIQGEAYSVRSDVWSAGLTIMELAVGRFPFDSSDTAAGDRASAGPMGILDLLQQIVHEPAPKLPKSDAFPTILDEFVAKCLLKKQENDQLHVNFL

HMMPfam: PF00069
IPR017442
70-278 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

VLKELGAGNGGTVSKVMHASTKVIMARKIIRVDAKEKVRKQILRELQVGRHCDSPYIVTFYGAFTNEARDIVLCMEYMDGGSLDRISKDFGPVRVDVLGKIAESIFAGLVYLYEAHRIMHRDIKPSNVLVNSRGHIKLCDFGVATETVNSVADTFVGTSTYMAPERIQGEAYSVRSDVWSAGLTIMELAVGRFPFDSSDTAAGDRASAG

PatternScan: PS00107
IPR017441
74-97 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGAGNGGTVSKVMHASTKVIMARK

Gene3D: G3DSA:1.10.510.10
134-320 no description

TNEARDIVLCMEYMDGGSLDRISKDFGPVRVDVLGKIAESIFAGLVYLYEAHRIMHRDIKPSNVLVNSRGHIKLCDFGVATETVNSVADTFVGTSTYMAPERIQGEAYSVRSDVWSAGLTIMELAVGRFPFDSSDTAAGDRASAGPMGILDLLQQIVHEPAPKLPKSDAFPTILDEFVAKCLLKKQE

PatternScan: PS00108
IPR008271
187-199 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IMHRDIKPSNVLV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox