PRGDB00079594 (Cpp.610)

From PRG Wiki
Jump to: navigation, search
Cpp.610
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 186874430 (EX275903)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis lyrata subsp. lyrata

Comment?

1456855_5_B13_063 PY06 Carica papaya cDNA, mRNA sequence

DNA Sequence

ACCCGGGAATGGCCCGGGGGTTCGGCCATTACGGCCGGGGATTATTTcaaaaaatcaaacgaacaaaaaagcttcgtagctctatttgatcttctttcttttttcttgagaaaattaatcttcttcttCCAAGTATGTAAAGCTTGTCAGATTACTTAATATGGCCGCCGTTTATTAGCGTCTTAACTCGAGGTAGGGACTATGTCGTGGGAAAGAAAATAGCAGTAACTTACCGTAGACAGATATGGGTTGTATTTGCTTCAGTGCGTCAACTGCAGCCAAAAAACAGAGTACTAGTCAAATTCCACACGGCATAGATGGGCAATTGCTTGGTAATGTAAACAATTTGTCCTACAAAGAATTAAGATCGGCAGCAGATAATTTTCATTCAAGCAAGAAGATAGGACGTGGTGGTTTTGGAACTGTTTACAAGGGAATTCTAAGGAGTGGAAAAGAAGTTGCCATTAAGACACTCTCTGCAGAATCAAAGCAGGGAGTGCATGAATTTTTGACCGAGATAAATACAATCTCCAATGTCAAGCATCCAAACCTGGTTGAGTTAGTCGGTTGCTGTGTTCAAGGAAATAACCGGATCTTGGTCTATGAATATGTAGAAAATAACAGCCTTGATCGAGCATTGTTAGGTCGAAGTAGAAATATCAAACTGGACTGGGGTCAAAGATCTAATATTTGCTTGGGCATTGCCAGGGGTCTTGCATTCCTTCATGAAGAAGTTACACCACATATTGTACATAGAGACATCAAAGCTAGTAATATACTTCTTGACAAGGATTTTAGCCCCAAAATAGGAGATTTTGGGTTGGCCAAACTTTTCCCGGATGATATTACTCATATTAGCACAAGAATAGCAGGAACAACGTAAGTCATCTTTCAGATAGTTAGTTGACTGGGTCTTGGTTCTTGACATTGGTTCTCTACATTGCATCAGTTTCACCTTCTCTTTTCTCTGACTGAACTGGAATACTCTCACTGTTGAATTCTGTTCTGGAGCCTTCTTGCTCTGTCAATTGCAGTGGGCATGATACCTACTCTATTTGCTAAGGTAGGATAAGCAGGGAAGAAGGCTTTTTATTAAATTGAAAAAGG


Protein sequences

Name Description Sequence
Cpp.610 translated coding region predicted by ESTScan from UniGene Cpp.610

MGCICFSASTAAKKQSTSQIPHGIDGQLLGNVNNLSYKELRSAADNFHSSKKIGRGGFGTVYKGILRSGKEVAIKTLSAESKQGVHEFLTEINTISNVKHPNLVELVGCCVQGNNRILVYEYVENNSLDRALLGRSRNIKLDWGQRSNICLGIARGLAFLHEEVTPHIVHRDIKASNILLDKDFSPKIGDFGLAKLFPDDITHISTRIAGTT

Domains

Domain Start-End Description Sequence

Seg: seg
7-19 seg

SASTAAKKQSTSQ

HMMPanther: PTHR24420:SF679
18-212 SUBFAMILY NOT NAMED

SQIPHGIDGQLLGNVNNLSYKELRSAADNFHSSKKIGRGGFGTVYKGILRSGKEVAIKTLSAESKQGVHEFLTEINTISNVKHPNLVELVGCCVQGNNRILVYEYVENNSLDRALLGRSRNIKLDWGQRSNICLGIARGLAFLHEEVTPHIVHRDIKASNILLDKDFSPKIGDFGLAKLFPDDITHISTRIAGTT

HMMPanther: PTHR24420
18-212 FAMILY NOT NAMED,FAMILY NOT NAMED

SQIPHGIDGQLLGNVNNLSYKELRSAADNFHSSKKIGRGGFGTVYKGILRSGKEVAIKTLSAESKQGVHEFLTEINTISNVKHPNLVELVGCCVQGNNRILVYEYVENNSLDRALLGRSRNIKLDWGQRSNICLGIARGLAFLHEEVTPHIVHRDIKASNILLDKDFSPKIGDFGLAKLFPDDITHISTRIAGTT

superfamily: SSF56112
IPR011009
19-211 Protein kinase-like (PK-like)
Protein kinase-like domain

QIPHGIDGQLLGNVNNLSYKELRSAADNFHSSKKIGRGGFGTVYKGILRSGKEVAIKTLSAESKQGVHEFLTEINTISNVKHPNLVELVGCCVQGNNRILVYEYVENNSLDRALLGRSRNIKLDWGQRSNICLGIARGLAFLHEEVTPHIVHRDIKASNILLDKDFSPKIGDFGLAKLFPDDITHISTRIAGT

Gene3D: G3DSA:3.30.200.20
31-109 no description

NVNNLSYKELRSAADNFHSSKKIGRGGFGTVYKGILRSGKEVAIKTLSAESKQGVHEFLTEINTISNVKHPNLVELVGC

ProfileScan: PS50011
IPR000719
47-212 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FHSSKKIGRGGFGTVYKGILRSGKEVAIKTLSAESKQGVHEFLTEINTISNVKHPNLVELVGCCVQGNNRILVYEYVENNSLDRALLGRSRNIKLDWGQRSNICLGIARGLAFLHEEVTPHIVHRDIKASNILLDKDFSPKIGDFGLAKLFPDDITHISTRIAGTT

HMMSmart: SM00219
IPR020635
47-212 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FHSSKKIGRGGFGTVYKGILRSGKEVAIKTLSAESKQGVHEFLTEINTISNVKHPNLVELVGCCVQGNNRILVYEYVENNSLDRALLGRSRNIKLDWGQRSNICLGIARGLAFLHEEVTPHIVHRDIKASNILLDKDFSPKIGDFGLAKLFPDDITHISTRIAGTT

HMMSmart: SM00220
IPR002290
47-211 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FHSSKKIGRGGFGTVYKGILRSGKEVAIKTLSAESKQGVHEFLTEINTISNVKHPNLVELVGCCVQGNNRILVYEYVENNSLDRALLGRSRNIKLDWGQRSNICLGIARGLAFLHEEVTPHIVHRDIKASNILLDKDFSPKIGDFGLAKLFPDDITHISTRIAGT

HMMPfam: PF00069
IPR017442
48-206 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

HSSKKIGRGGFGTVYKGILRSGKEVAIKTLSAESKQGVHEFLTEINTISNVKHPNLVELVGCCVQGNNRILVYEYVENNSLDRALLGRSRNIKLDWGQRSNICLGIARGLAFLHEEVTPHIVHRDIKASNILLDKDFSPKIGDFGLAKLFPDDITHIST

PatternScan: PS00107
IPR017441
53-75 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGRGGFGTVYKGILRSGKEVAIK

Gene3D: G3DSA:1.10.510.10
110-209 no description

CVQGNNRILVYEYVENNSLDRALLGRSRNIKLDWGQRSNICLGIARGLAFLHEEVTPHIVHRDIKASNILLDKDFSPKIGDFGLAKLFPDDITHISTRIA

PatternScan: PS00108
IPR008271
168-180 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDIKASNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox