PRGDB00079597 (Cpp.714)

From PRG Wiki
Jump to: navigation, search
Cpp.714
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 186871021 (EX300932)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis lyrata subsp. lyrata

Comment?

1615496_5_H14_057 PY06 Carica papaya cDNA, mRNA sequence

DNA Sequence

GCGGGAATTGGCCGGGGATTCGGGCCATTACGGCCGGGGACGGATGATAGAAACACAAGAGAGACTTAGAAAAGAGCGCGAGGAAATCCTCAACGCCAACAATGCTGGCAAGATGGCCAAAGTCTTCAGCGGAAAAGAAGTCAAGAAAGCAACCAATAATTTCTCTCGAGATCGCCTACTCGGCTCCGGTGGGTATGGAGATGTCTACAAAGGAATTCTCGAAGACGGTACTGCAGTAGCCATGAAATGTGCCAAGTTAGGCAACGCCAAAGGCACTGACCAAGTCCTCAATGAGGTTAGAATCTTATGTCAAGTCAATCATAGGAGCCTTGTAGGTTTACTTGGATGTTGTGTGGAACTTGAGCAACCTGTCATGGTTTATGAGTACATTGCCAATGGCAATTTATATGATCGATTGCATGCTATGGGAATCGATGAAAGAAGCCAATTAACCTGGAAATGTCGTCTCCAAATTGCATACGACACTGCTGAAGGTCTCGCGTACCTTCATTCCTCCGCAGTTCCCCCTATTTATCATCGAGATGTCAAGTCTAGTAACATACTTCTTGATGAGAAATTGAATGCTAAAGTTTCAGATTTTGGGACTCTCTCGATTAGCTCATACCGATATGAGCCATATATCGACATGTGCTCAAGGAACCCTCGGGATACTTAGACCCAGAGTACTATCGGGAACTATCAATTGACTGATAAGAGTGATGTTTATAGTTTTGGGTGTGGTGTTGTTGGAGCTTCGAACTTC


Protein sequences

Name Description Sequence
Cpp.714 translated coding region predicted by ESTScan from UniGene Cpp.714

XRELAGDSGHYGRGRMIETQERLRKEREEILNANNAGKMAKVFSGKEVKKATNNFSRDRLLGSGGYGDVYKGILEDGTAVAMKCAKLGNAKGTDQVLNEVRILCQVNHRSLVGLLGCCVELEQPVMVYEYIANGNLYDRLHAMGIDERSQLTWKCRLQIAYDTAEGLAYLHSSAVPPIYHRDVKSSNILLDEKLNAKVSDFGTLSISSYRYEPYIDMCSRNPRDTXTQSTIGNYQLTDKSDVYSFGCGVVGASNF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF691
15-246 SUBFAMILY NOT NAMED

RMIETQERLRKEREEILNANNAGKMAKVFSGKEVKKATNNFSRDRLLGSGGYGDVYKGILEDGTAVAMKCAKLGNAKGTDQVLNEVRILCQVNHRSLVGLLGCCVELEQPVMVYEYIANGNLYDRLHAMGIDERSQLTWKCRLQIAYDTAEGLAYLHSSAVPPIYHRDVKSSNILLDEKLNAKVSDFGTLSISSYRYEPYIDMCSRNPRDTXTQSTIGNYQLTDKSDVYSFG

HMMPanther: PTHR24420
15-246 FAMILY NOT NAMED,FAMILY NOT NAMED

RMIETQERLRKEREEILNANNAGKMAKVFSGKEVKKATNNFSRDRLLGSGGYGDVYKGILEDGTAVAMKCAKLGNAKGTDQVLNEVRILCQVNHRSLVGLLGCCVELEQPVMVYEYIANGNLYDRLHAMGIDERSQLTWKCRLQIAYDTAEGLAYLHSSAVPPIYHRDVKSSNILLDEKLNAKVSDFGTLSISSYRYEPYIDMCSRNPRDTXTQSTIGNYQLTDKSDVYSFG

Coil: coil
16-37 coiled-coil

MIETQERLRKEREEILNANNAG

superfamily: SSF56112
IPR011009
27-247 Protein kinase-like (PK-like)
Protein kinase-like domain

REEILNANNAGKMAKVFSGKEVKKATNNFSRDRLLGSGGYGDVYKGILEDGTAVAMKCAKLGNAKGTDQVLNEVRILCQVNHRSLVGLLGCCVELEQPVMVYEYIANGNLYDRLHAMGIDERSQLTWKCRLQIAYDTAEGLAYLHSSAVPPIYHRDVKSSNILLDEKLNAKVSDFGTLSISSYRYEPYIDMCSRNPRDTXTQSTIGNYQLTDKSDVYSFGC

Gene3D: G3DSA:3.30.200.20
38-116 no description

KMAKVFSGKEVKKATNNFSRDRLLGSGGYGDVYKGILEDGTAVAMKCAKLGNAKGTDQVLNEVRILCQVNHRSLVGLLG

ProfileScan: PS50011
IPR000719
55-255 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSRDRLLGSGGYGDVYKGILEDGTAVAMKCAKLGNAKGTDQVLNEVRILCQVNHRSLVGLLGCCVELEQPVMVYEYIANGNLYDRLHAMGIDERSQLTWKCRLQIAYDTAEGLAYLHSSAVPPIYHRDVKSSNILLDEKLNAKVSDFGTLSISSYRYEPYIDMCSRNPRDTXTQSTIGNYQLTDKSDVYSFGCGVVGASNF

HMMSmart: SM00220
IPR002290
55-255 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSRDRLLGSGGYGDVYKGILEDGTAVAMKCAKLGNAKGTDQVLNEVRILCQVNHRSLVGLLGCCVELEQPVMVYEYIANGNLYDRLHAMGIDERSQLTWKCRLQIAYDTAEGLAYLHSSAVPPIYHRDVKSSNILLDEKLNAKVSDFGTLSISSYRYEPYIDMCSRNPRDTXTQSTIGNYQLTDKSDVYSFGCGVVGASNF

HMMSmart: SM00219
IPR020635
55-255 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSRDRLLGSGGYGDVYKGILEDGTAVAMKCAKLGNAKGTDQVLNEVRILCQVNHRSLVGLLGCCVELEQPVMVYEYIANGNLYDRLHAMGIDERSQLTWKCRLQIAYDTAEGLAYLHSSAVPPIYHRDVKSSNILLDEKLNAKVSDFGTLSISSYRYEPYIDMCSRNPRDTXTQSTIGNYQLTDKSDVYSFGCGVVGASNF

HMMPfam: PF07714
IPR001245
58-247 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

DRLLGSGGYGDVYKGILEDGTAVAMKCAKLGNAKGTDQVLNEVRILCQVNHRSLVGLLGCCVELEQPVMVYEYIANGNLYDRLHAMGIDERSQLTWKCRLQIAYDTAEGLAYLHSSAVPPIYHRDVKSSNILLDEKLNAKVSDFGTLSISSYRYEPYIDMCSRNPRDTXTQSTIGNYQLTDKSDVYSFGC

PatternScan: PS00107
IPR017441
61-83 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGSGGYGDVYKGILEDGTAVAMK

Gene3D: G3DSA:1.10.510.10
117-247 no description

CCVELEQPVMVYEYIANGNLYDRLHAMGIDERSQLTWKCRLQIAYDTAEGLAYLHSSAVPPIYHRDVKSSNILLDEKLNAKVSDFGTLSISSYRYEPYIDMCSRNPRDTXTQSTIGNYQLTDKSDVYSFGC

PatternScan: PS00108
IPR008271
178-190 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IYHRDVKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox