PRGDB00079599 (Cpp.832)

From PRG Wiki
Jump to: navigation, search
Cpp.832
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 186873039 (EX262853)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis lyrata subsp. lyrata

Comment?

1443348_5_O18_065 PY06 Carica papaya cDNA, mRNA sequence

DNA Sequence

CGAGGGGTGTAGGGCACGCGGCTGCCGGGAGTCGGCCGTTACGGCCGGGAGTGTTGAAAATCTTCTTGGTGAGGGGTCTTTTGGACGTGTTTATCGGGCTCAATTTGATGATGGGAAGGTGCTTGCCGTGAAGAAAATTGACTCATCAGCACTTCCTGGTGAAATGTCAGAAGAATTTACGGAGATAGTGTCAAGTATCTCCCGGTTGCATCATCCAAATGTAACAGAGTTGGTTGGTTATTGTTCAGAGCATGGACAGCACCTGCTAATCTATGAGTTCCATAAAAATGGCTCATTGCATGACTTCCTGCATCTGTCAGATGAGTATAGCAAACCATTGATATGGAATTCACGCGTTAAAATTGCTCTTGGAACTGCTCGTGCATTAGAGTACCTGCATGAAGTCTGCTCACCATCCATTATTCACAAAAATATGAAATCAGCCAACATTTTACTAGATTCTGAGCTCAATCCTCATCTATCAGACTCTGGCATTGCAAGCTTTTCCCCAAATGCAGATAAGGTATTGAACCAAAACGATGAAGGGTCTGGATATAGTGCACCTGAGGTTGCCATGTCTGGTCAATACACTCTAAAAAGTGACGTTTACAGTTTTGGAGTTGTTATGCTGGAACTTTTAACCGGACGGAAGTCATTTGATAGCTCAAGATCAAGGTCTGAGCAATCTTTGGTTCGATGGGCAACACCTCAGCTCCACGACATTGATGCTCTAGCTAAAATGGTTGATCCGGCTCTTAAAGGACTCTATCCAGTTAAATCTCTCTCCCGATTTGCTGATGTGATTGCCCTTTGTGTCCAGCCGGAACCCGAGTTCCGACCACCTATGTCAGAAGTTGTTCAAGCATTGGTACGGTTAGTGCAGCGAGCAAACATGAACAAAAGGACTATAGGAGTTGACCAACGCGCATCACGAGGTGACGACCTGGGTACAAACGATTACATGTGATGGATTGTAGCACTGAGATTTCTTGGTGATGACATTTAGATGTCTTCTTTTTCCCTTTAAAGGATGTAATACTGCTGGAG


Protein sequences

Name Description Sequence
Cpp.832 translated coding region predicted by ESTScan from UniGene Cpp.832

XEGCRARGCRESAVTAGSVENLLGEGSFGRVYRAQFDDGKVLAVKKIDSSALPGEMSEEFTEIVSSISRLHHPNVTELVGYCSEHGQHLLIYEFHKNGSLHDFLHLSDEYSKPLIWNSRVKIALGTARALEYLHEVCSPSIIHKNMKSANILLDSELNPHLSDSGIASFSPNADKVLNQNDEGSGYSAPEVAMSGQYTLKSDVYSFGVVMLELLTGRKSFDSSRSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVQALVRLVQRANMNKRTIGVDQRASRGDDLGTNDYM

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
17-293 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

GSVENLLGEGSFGRVYRAQFDDGKVLAVKKIDSSALPGEMSEEFTEIVSSISRLHHPNVTELVGYCSEHGQHLLIYEFHKNGSLHDFLHLSDEYSKPLIWNSRVKIALGTARALEYLHEVCSPSIIHKNMKSANILLDSELNPHLSDSGIASFSPNADKVLNQNDEGSGYSAPEVAMSGQYTLKSDVYSFGVVMLELLTGRKSFDSSRSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVQALVRL

HMMSmart: SM00219
IPR020635
17-290 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

GSVENLLGEGSFGRVYRAQFDDGKVLAVKKIDSSALPGEMSEEFTEIVSSISRLHHPNVTELVGYCSEHGQHLLIYEFHKNGSLHDFLHLSDEYSKPLIWNSRVKIALGTARALEYLHEVCSPSIIHKNMKSANILLDSELNPHLSDSGIASFSPNADKVLNQNDEGSGYSAPEVAMSGQYTLKSDVYSFGVVMLELLTGRKSFDSSRSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVQAL

HMMSmart: SM00220
IPR002290
17-291 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

GSVENLLGEGSFGRVYRAQFDDGKVLAVKKIDSSALPGEMSEEFTEIVSSISRLHHPNVTELVGYCSEHGQHLLIYEFHKNGSLHDFLHLSDEYSKPLIWNSRVKIALGTARALEYLHEVCSPSIIHKNMKSANILLDSELNPHLSDSGIASFSPNADKVLNQNDEGSGYSAPEVAMSGQYTLKSDVYSFGVVMLELLTGRKSFDSSRSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVQALV

HMMPanther: PTHR24420:SF463
18-322 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

SVENLLGEGSFGRVYRAQFDDGKVLAVKKIDSSALPGEMSEEFTEIVSSISRLHHPNVTELVGYCSEHGQHLLIYEFHKNGSLHDFLHLSDEYSKPLIWNSRVKIALGTARALEYLHEVCSPSIIHKNMKSANILLDSELNPHLSDSGIASFSPNADKVLNQNDEGSGYSAPEVAMSGQYTLKSDVYSFGVVMLELLTGRKSFDSSRSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVQALVRLVQRANMNKRTIGVDQRASRGDDLGTNDYM

HMMPanther: PTHR24420
18-322 FAMILY NOT NAMED,FAMILY NOT NAMED

SVENLLGEGSFGRVYRAQFDDGKVLAVKKIDSSALPGEMSEEFTEIVSSISRLHHPNVTELVGYCSEHGQHLLIYEFHKNGSLHDFLHLSDEYSKPLIWNSRVKIALGTARALEYLHEVCSPSIIHKNMKSANILLDSELNPHLSDSGIASFSPNADKVLNQNDEGSGYSAPEVAMSGQYTLKSDVYSFGVVMLELLTGRKSFDSSRSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVQALVRLVQRANMNKRTIGVDQRASRGDDLGTNDYM

superfamily: SSF56112
IPR011009
18-298 Protein kinase-like (PK-like)
Protein kinase-like domain

SVENLLGEGSFGRVYRAQFDDGKVLAVKKIDSSALPGEMSEEFTEIVSSISRLHHPNVTELVGYCSEHGQHLLIYEFHKNGSLHDFLHLSDEYSKPLIWNSRVKIALGTARALEYLHEVCSPSIIHKNMKSANILLDSELNPHLSDSGIASFSPNADKVLNQNDEGSGYSAPEVAMSGQYTLKSDVYSFGVVMLELLTGRKSFDSSRSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVQALVRLVQRAN

Gene3D: G3DSA:3.30.200.20
19-80 no description

VENLLGEGSFGRVYRAQFDDGKVLAVKKIDSSALPGEMSEEFTEIVSSISRLHHPNVTELVG

HMMPfam: PF00069
IPR017442
20-288 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

ENLLGEGSFGRVYRAQFDDGKVLAVKKIDSSALPGEMSEEFTEIVSSISRLHHPNVTELVGYCSEHGQHLLIYEFHKNGSLHDFLHLSDEYSKPLIWNSRVKIALGTARALEYLHEVCSPSIIHKNMKSANILLDSELNPHLSDSGIASFSPNADKVLNQNDEGSGYSAPEVAMSGQYTLKSDVYSFGVVMLELLTGRKSFDSSRSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVQ

PatternScan: PS00107
IPR017441
23-46 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGSFGRVYRAQFDDGKVLAVKK

Gene3D: G3DSA:1.10.510.10
81-290 no description

YCSEHGQHLLIYEFHKNGSLHDFLHLSDEYSKPLIWNSRVKIALGTARALEYLHEVCSPSIIHKNMKSANILLDSELNPHLSDSGIASFSPNADKVLNQNDEGSGYSAPEVAMSGQYTLKSDVYSFGVVMLELLTGRKSFDSSRSRSEQSLVRWATPQLHDIDALAKMVDPALKGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVQAL

Seg: seg
217-233 seg

RKSFDSSRSRSEQSLVR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox