PRGDB00079612 (Cpp.1490)

From PRG Wiki
Jump to: navigation, search
Cpp.1490
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 186721259 (EX275916)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis lyrata subsp. lyrata

Comment?

1456907_5_D17_077 PY06 Carica papaya cDNA, mRNA sequence

DNA Sequence

CCCGCAAGGGGCGGGGGATCGGCCATTACGGCCGGGTGGTGAACTTGCGCCTGATGGAGAGAAATCTGTTGTGACAAGGCTTGCTGGGACTTTTGGATACTTGGCTCCAGAATATGCTGTGACAGGAAAAATTACAACAAAAGCTGATGTCTTCAGTTTCGGGGTCGTGTTGATGGAGCTTTTGACTGGTTTAATGGCACTTGATGAGGATCGGCCTGAGGAAAGCCAATACTTGGCTGCATGGTTTTGGAAGATCAGATTAGATAAGGAGAAACTGAGGGCTGCTATTGACTCAGCTCTCGATGTTAAAGACGAAGAAACCTTCGAGAGCATTTCTATCATTGCTGAACTGGCTGGACACTGCACCGCAAGGGAACCCAACCAGCGGCCAGATATGGGTCATGCCGTGAATGTTCTTGCTCCACTTGTCGAGAAATGGAAGCCTCTTGATGATGATTTGGAGGAATATTCAGGCATCGACTATAGCCTTCCCTCTTAACCAGATGGTGAAAGGGATGGCAGGAGGCAGAAGGGAAAGATTTCAGCTACACGAGCCTGGAAGACAGCAAGGGTAGCATCCCGGCAAGGCCAACCGGATTTGCTGATTCCTTCACTTCAGCCGATGGCCGATGAAGAAAAAATGAAAGGTAAATTTGTACTTGTATAGTCAAACAGTTCGTTTCTCAAGGTGTAGATAGAGTGTCTTGAATCTTTGTATCTGAAATGAAATTTAATGTTAATATATATGTATTATATGGTCGTATGTTTTCATTTAAGTTGGAGAAGCTGATGAACTAGAGTTCCTCATTTTGTAGCTTTGGACTACTCGTAATGGAATTTTGAGGGTTATGACCAATAAAAAATAggccgcctcggccctcgagagctttctagaccattcgttggcgcgcggCCAGCTAGTTATGGACATGTCATACTGGTTTCTTAGAGATCTGTCCATGACTATGCCTGAATTCTACATAAAAGCTCGCGGATCCTGAGGTCTGACATCGATATGACTCGAGGCTTACTGATATGAT


Protein sequences

Name Description Sequence
Cpp.1490 translated coding region predicted by ESTScan from UniGene Cpp.1490

XPQGAGDRPLRPGGELAPDGEKSVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGLMALDEDRPEESQYLAAWFWKIRLDKEKLRAAIDSALDVKDEETFESISIIAELAGHCTAREPNQRPDMGHAVNVLAPLVEKWKPLDDDLEEYSGIDYSLPSXPDGERDGQEAEGKDFSYTSLEDSKGSIPARPTGFADSFTSADGR

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-144 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XPQGAGDRPLRPGGELAPDGEKSVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGLMALDEDRPEESQYLAAWFWKIRLDKEKLRAAIDSALDVKDEETFESISIIAELAGHCTAREPNQRPDMGHAVNVLAPLV

HMMPanther: PTHR24420:SF467
16-202 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LAPDGEKSVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGLMALDEDRPEESQYLAAWFWKIRLDKEKLRAAIDSALDVKDEETFESISIIAELAGHCTAREPNQRPDMGHAVNVLAPLVEKWKPLDDDLEEYSGIDYSLPSXPDGERDGQEAEGKDFSYTSLEDSKGSIPARPTGFA

HMMPanther: PTHR24420
16-202 FAMILY NOT NAMED,FAMILY NOT NAMED

LAPDGEKSVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGLMALDEDRPEESQYLAAWFWKIRLDKEKLRAAIDSALDVKDEETFESISIIAELAGHCTAREPNQRPDMGHAVNVLAPLVEKWKPLDDDLEEYSGIDYSLPSXPDGERDGQEAEGKDFSYTSLEDSKGSIPARPTGFA

HMMPfam: PF00069
IPR017442
21-137 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

EKSVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGLMALDEDRPEESQYLAAWFWKIRLDKEKLRAAIDSALDVKDEETFESISIIAELAGHCTAREPNQRPDMGHAV

Gene3D: G3DSA:1.10.510.10
22-157 no description

KSVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGLMALDEDRPEESQYLAAWFWKIRLDKEKLRAAIDSALDVKDEETFESISIIAELAGHCTAREPNQRPDMGHAVNVLAPLVEKWKPLDDDLEEY

superfamily: SSF56112
IPR011009
24-163 Protein kinase-like (PK-like)
Protein kinase-like domain

VVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGLMALDEDRPEESQYLAAWFWKIRLDKEKLRAAIDSALDVKDEETFESISIIAELAGHCTAREPNQRPDMGHAVNVLAPLVEKWKPLDDDLEEYSGIDYS

HMMPfam: PF08858
IPR014957
88-111 IDEAL
Uncharacterised protein family UPF0302, C-terminal

LDKEKLRAAIDSALDVKDEETFES






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox