PRGDB00079613 (Cpp.1574)

From PRG Wiki
Jump to: navigation, search
Cpp.1574
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 186856930 (EX267639)
Gene Class Unknown
Domain Type LRR
Gene Species Arabidopsis lyrata subsp. lyrata

Comment?

1448067_5_D09_045 PY06 Carica papaya cDNA, mRNA sequence

DNA Sequence

ATGGGAGCTAGTCTTTTATCGGTTTCGGGATTCGGCCATTACGGCCGGGGAAGTGGGTTTGCTTGTAGATTGTCTTTTTTTGCTTTGAAGGTTTTGCTTTAAGCCTTCAATTTCTCCATTACCCTTCTCGTTTCTCTGTCCTGGAACATGAATCCTCTCCCTCTCAtcttcctttttcttctttcttcttcacttcatttctCCCCTGTTATCTCCACAAATTCTGAAGGAAATGCTCTGCATGCTCTGAGAAGCAGACTTTCTGACCCAAGAAATGTGTTGCAGAGCTGGGACCCAACTCTGGTTAATGCCTGCACTTGGTTTCATGTCACCTGTGATTCTAACAATCATGTAATTCGCTTAGACTTGGGCAACTCTAACATTTCTGGGACTTTGGGACCTGAACTGGGCCAACTTCAGCATCTGCAGTACTTGGAGCTTTACAGGAATGATATAGGAGGGAAGATCCCAGAGGAGTTAGGTAACTTGAAAAGCCTTGTTAGCATGGATCTGTATGGAAACCGATTTGAGGGAGAGATTCCCAAGTCGTTTGCCAAGTTGAAATCACTCAAATTTCTTCGACTGAACAACAACAAGCTGTCCGGATCAATCCCCAGGGAACTCACCAACCTCCCGAACCTCAAAGTTTTTGACGTTTCGAACAATGATTTGTGCGGAACGATTCCAGTAGATGGCCCGTTGGGAGTTTCCCAATGGAGAGCTACGAGAACAACAGGCTCAACGGACCAGAGTTGAAGGGACTGGTGCCTTACGATTTCGGATGCTGAGTACCAGAATTGGTCAGTCCCTCGCTGTAAGATGAACAAGTAACCCCCTGGCCTCCCATCCACGGGTGGTTAGTTTGTAGTACCAAATATTACATCCCGTAAGCTGTGTTGTGTTTTAATACTTTACCACTCTGGCGAGCAAATAGAGGGATTGTTGGGAGTATCGAAATCTCGAGATTACAGTCTTTGTCGAGAAGACATATTAATAATAGGGTTCGATCTACATAAGTCGATAGAATACCGACCTGATATTTGAGATGAAATAACAGAACATGGAACATTTTACCTGTCAAAAAATAATAGGGCCGCCCTCGGGCCTCGGGAAGCCTTCTAGACATCGATTGGGCCGCCGGGCCAGTAGTAAGGAACATGCATAGCGGTCT


Protein sequences

Name Description Sequence
Cpp.1574 translated coding region predicted by ESTScan from UniGene Cpp.1574

MNPLPLIFLFLLSSSLHFSPVISTNSEGNALHALRSRLSDPRNVLQSWDPTLVNACTWFHVTCDSNNHVIRLDLGNSNISGTLGPELGQLQHLQYLELYRNDIGGKIPEELGNLKSLVSMDLYGNRFEGEIPKSFAKLKSLKFLRLNNNKLSGSIPRELTNLPNLKVFDVSNNDLCGTIPVDGPLGVSQWRATRTTGSTDQSXRDWCLTISDAEYQNWSVPRCKMNK


Domains

Domain Start-End Description Sequence

Seg: seg
3-20 seg

PLPLIFLFLLSSSLHFSP

HMMPanther: PTHR24420:SF836
6-182 SUBFAMILY NOT NAMED

LIFLFLLSSSLHFSPVISTNSEGNALHALRSRLSDPRNVLQSWDPTLVNACTWFHVTCDSNNHVIRLDLGNSNISGTLGPELGQLQHLQYLELYRNDIGGKIPEELGNLKSLVSMDLYGNRFEGEIPKSFAKLKSLKFLRLNNNKLSGSIPRELTNLPNLKVFDVSNNDLCGTIPVD

HMMPanther: PTHR24420
6-182 FAMILY NOT NAMED,FAMILY NOT NAMED

LIFLFLLSSSLHFSPVISTNSEGNALHALRSRLSDPRNVLQSWDPTLVNACTWFHVTCDSNNHVIRLDLGNSNISGTLGPELGQLQHLQYLELYRNDIGGKIPEELGNLKSLVSMDLYGNRFEGEIPKSFAKLKSLKFLRLNNNKLSGSIPRELTNLPNLKVFDVSNNDLCGTIPVD

superfamily: SSF52058
21-180 L domain-like,LRR

VISTNSEGNALHALRSRLSDPRNVLQSWDPTLVNACTWFHVTCDSNNHVIRLDLGNSNISGTLGPELGQLQHLQYLELYRNDIGGKIPEELGNLKSLVSMDLYGNRFEGEIPKSFAKLKSLKFLRLNNNKLSGSIPRELTNLPNLKVFDVSNNDLCGTIP

Gene3D: G3DSA:3.80.10.10
25-180 no description

NSEGNALHALRSRLSDPRNVLQSWDPTLVNACTWFHVTCDSNNHVIRLDLGNSNISGTLGPELGQLQHLQYLELYRNDIGGKIPEELGNLKSLVSMDLYGNRFEGEIPKSFAKLKSLKFLRLNNNKLSGSIPRELTNLPNLKVFDVSNNDLCGTIP

HMMPfam: PF08263
IPR013210
25-64 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

NSEGNALHALRSRLSDPRNVLQSWDPTLVNACTWFHVTCD

HMMPfam: PF13516
90-113 LRR_6,Leucine Rich repeat

LQHLQYLELYRNDIGGKIPEELGN

HMMPfam: PF00560
IPR001611
116-138 LRR_1
Leucine-rich repeat

SLVSMDLYGNRFEGEIPKSFAKL

Seg: seg
133-146 seg

KSFAKLKSLKFLRL

HMMPfam: PF12799
139-176 LRR_4,Leucine Rich repeats (2 copies)

KSLKFLRLNNNKLSGSIPRELTNLPNLKVFDVSNNDLC






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox