PRGDB00079617 (Cpp.1837)

From PRG Wiki
Jump to: navigation, search
Cpp.1837
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 186794470 (EX262875)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis lyrata subsp. lyrata

Comment?

1443080_5_D14_061 PY06 Carica papaya cDNA, mRNA sequence

DNA Sequence

CGAGCAAGCAGTTAATTCCGATGCCGGGGGATCGGCCATTACGGCCGGGGATGTGATAGACCGGTGATACACCGTGATGTTAAGTCGAGTAATATCTTGTTGGATGAGGAATGGAAGCCTAGAATTGCAGATTTTGGTCTGGCCAAGATTGTGCAGGCAGGTGGGGAAGGGGATTGGACTAATGTCATTGCTGGCACTCATGGTTACATTGCTCCAGAATATGCGTACACGTGCAAAATAACGGAGAAAAGTGATGTATATAGCTTTGGAGTAGTGCTGATGGAGTTGGTGACGGGAAAAAGACCGGTAGAGGCAGAATTCGGAGAGAACAAAGACATAGTGTATTGGGTAAGCAGTAAAATGAAGAGCCAAGAGAGTTTGGTTGAGCTGGTTGACCCGAGCATCTCAGAAGCCATGAAAGATGATGCTGCCAACGTGCTAAGAATTGCACTACTTTGTACTGTGAGAGTCCCAGCTCTAAGGCCTTCCATGAGAATGATAGTTCAAATGCTGGAGCATGCTGAGCCATGTCAACTTACCAACATCATTGTTCATATAGGGCACGAAGAAGGTAGCCCGGACGAGAAATCAAAGACGCTCGGATGATTTGCATTTTTGAATTTGAATCGAGCTTAAACAAGGTCCTGAAATATTTTTTGTTACACCTGTACTTCACTTGATTTTAGCCTAAAAGTTTAAAAATGTATTATTAGATCTATATACTTGGATTAGACACACTCAATTTGCAAGATGCATTATTGAGATTTTAGCTCACaaaaaaaaaaaaaaggccgcctcggccctcgagaagctttctagaccattcgtttggcgcgcgggcccagtagtaagtgaacatggtcatagctgtttcctaggagatcctggtcatgactagtgcttggattctcaccaataaaaaacgcccggcggcaaccgagcgttctgaacaaatccagatggagttctgagtcattactggatctatcacagagtccaagcgagctcgatatcaattacgcccccgccctgccactcatcgcagtactgtgta


Protein sequences

Name Description Sequence
Cpp.1837 translated coding region predicted by ESTScan from UniGene Cpp.1837

RASSXFRCRGIGHYGRGCDRPVIHRDVKSSNILLDEEWKPRIADFGLAKIVQAGGEGDWTNVIAGTHGYIAPEYAYTCKITEKSDVYSFGVVLMELVTGKRPVEAEFGENKDIVYWVSSKMKSQESLVELVDPSISEAMKDDAANVLRIALLCTVRVPALRPSMRMIVQMLEHAEPCQLTNIIVHIGHEEGSPDEKSKTLG

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-176 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

RASSXFRCRGIGHYGRGCDRPVIHRDVKSSNILLDEEWKPRIADFGLAKIVQAGGEGDWTNVIAGTHGYIAPEYAYTCKITEKSDVYSFGVVLMELVTGKRPVEAEFGENKDIVYWVSSKMKSQESLVELVDPSISEAMKDDAANVLRIALLCTVRVPALRPSMRMIVQMLEHAEP

HMMSmart: SM00220
IPR002290
3-171 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

SSXFRCRGIGHYGRGCDRPVIHRDVKSSNILLDEEWKPRIADFGLAKIVQAGGEGDWTNVIAGTHGYIAPEYAYTCKITEKSDVYSFGVVLMELVTGKRPVEAEFGENKDIVYWVSSKMKSQESLVELVDPSISEAMKDDAANVLRIALLCTVRVPALRPSMRMIVQML

HMMSmart: SM00219
IPR020635
4-171 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

SXFRCRGIGHYGRGCDRPVIHRDVKSSNILLDEEWKPRIADFGLAKIVQAGGEGDWTNVIAGTHGYIAPEYAYTCKITEKSDVYSFGVVLMELVTGKRPVEAEFGENKDIVYWVSSKMKSQESLVELVDPSISEAMKDDAANVLRIALLCTVRVPALRPSMRMIVQML

superfamily: SSF56112
IPR011009
8-171 Protein kinase-like (PK-like)
Protein kinase-like domain

CRGIGHYGRGCDRPVIHRDVKSSNILLDEEWKPRIADFGLAKIVQAGGEGDWTNVIAGTHGYIAPEYAYTCKITEKSDVYSFGVVLMELVTGKRPVEAEFGENKDIVYWVSSKMKSQESLVELVDPSISEAMKDDAANVLRIALLCTVRVPALRPSMRMIVQML

Gene3D: G3DSA:1.10.510.10
12-174 no description

GHYGRGCDRPVIHRDVKSSNILLDEEWKPRIADFGLAKIVQAGGEGDWTNVIAGTHGYIAPEYAYTCKITEKSDVYSFGVVLMELVTGKRPVEAEFGENKDIVYWVSSKMKSQESLVELVDPSISEAMKDDAANVLRIALLCTVRVPALRPSMRMIVQMLEHA

HMMPanther: PTHR24420:SF800
17-176 SUBFAMILY NOT NAMED

GCDRPVIHRDVKSSNILLDEEWKPRIADFGLAKIVQAGGEGDWTNVIAGTHGYIAPEYAYTCKITEKSDVYSFGVVLMELVTGKRPVEAEFGENKDIVYWVSSKMKSQESLVELVDPSISEAMKDDAANVLRIALLCTVRVPALRPSMRMIVQMLEHAEP

HMMPanther: PTHR24420
17-176 FAMILY NOT NAMED,FAMILY NOT NAMED

GCDRPVIHRDVKSSNILLDEEWKPRIADFGLAKIVQAGGEGDWTNVIAGTHGYIAPEYAYTCKITEKSDVYSFGVVLMELVTGKRPVEAEFGENKDIVYWVSSKMKSQESLVELVDPSISEAMKDDAANVLRIALLCTVRVPALRPSMRMIVQMLEHAEP

HMMPfam: PF00069
IPR017442
21-169 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

PVIHRDVKSSNILLDEEWKPRIADFGLAKIVQAGGEGDWTNVIAGTHGYIAPEYAYTCKITEKSDVYSFGVVLMELVTGKRPVEAEFGENKDIVYWVSSKMKSQESLVELVDPSISEAMKDDAANVLRIALLCTVRVPALRPSMRMIVQ

PatternScan: PS00108
IPR008271
22-34 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDVKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox