PRGDB00079619 (Cpp.1886)

From PRG Wiki
Jump to: navigation, search
Cpp.1886
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 186801933 (EX275503)
Gene Class Unknown
Domain Type LRR
Gene Species Arabidopsis lyrata subsp. lyrata

Comment?

1456745_5_M23_084 PY06 Carica papaya cDNA, mRNA sequence

DNA Sequence

CCGCTAGTAGGAAAAGAGACCGCAGGCGGGATCGGCCATTACGGCCGGGACCAATATTCCATCGGGTTTCGGTTCGAGTCTCGAGGAACTAGTGTTCATCGAGAATCCAGCTTTGATTGGACCTGTCGATCGTATCATCGGTAATTTCACCAACTTAAGGAGGCTAGTTTTGTCCGGGACCGGGGTTTCTGGAAATATCCCAGAGAGTGTTGGTGATTTGGTTAGTCTCCAAGAGATTTCACTGTCAAGGAACAGGCTTAGTGGTGGGGTTCCCTTGAATTTGACCAAGTTGGAAAAGCTAAGGATTCTCGATTTGAGCTACAACGGACTTGACAGAAATGTCCCTGTATCCATAGGTAATCTCACGGAGCTTCTGAAGCTTGACTTGAGCTTCAATGGATTTTCTGGGGAAATCCCAGATAGCTTGGGGAGATTGCAGAGTTTGGAGTTTCTGGATCTGAGCTTTAATCGCTTCGGGAACTATGGAGTGCCTCTGTTTTTGGCAGATATGCCTAGATTGAGAGACGTGTATTTGAGTGGAAATTCCCTTGGTGGACAAATCCCGAGAATTTGGGAAAACCTTGGGGGCATTTTGGGAATTGGGTTTTCGAACATGGGACTTGTTGGGAGTATTCCGGCATCGATGGGAATGCATTTGAGAAATCTCTGTTACCTGAGACTTGACAACAACAAGCTTGAAGGGCAAGTACCAGAGGAGCTTGGATTGTTGAAAAATGCCAATGAAATCAATTTGGAGAACAACAATCTGAGTGGGAGGATACCGTTTTCAGCACAATTCAGAACTAGAATTGGGGAGAAATTGAAGCTAAGCGGGAATCCAGGCCTGTGTTTTGACGAGAAACAGAACTTTCCCAAAAAGGGTAACAGCAGACTAGAGCAATTCAAACTCTGCAACAACACAGGTACTCTAAATCCTGTGTTATGGGTTTCTAATCTTCTTCTTCTCATCATTCAGGCTTCTATTACCTACTTGTCATGTCATTTTGATTGTTATTGGGATTTTTGCTTGACTATTGACCAGGAATTAAGAGGAT


Protein sequences

Name Description Sequence
Cpp.1886 translated coding region predicted by ESTScan from UniGene Cpp.1886

XRXXEKRPQAGSAITAGTNIPSGFGSSLEELVFIENPALIGPVDRIIGNFTNLRRLVLSGTGVSGNIPESVGDLVSLQEISLSRNRLSGGVPLNLTKLEKLRILDLSYNGLDRNVPVSIGNLTELLKLDLSFNGFSGEIPDSLGRLQSLEFLDLSFNRFGNYGVPLFLADMPRLRDVYLSGNSLGGQIPRIWENLGGILGIGFSNMGLVGSIPASMGMHLRNLCYLRLDNNKLEGQVPEELGLLKNANEINLENNNLSGRIPFSAQFRTRIGEKLKLSGNPGLCFDEKQNFPKKGNSRLEQFKLCNNTGTLNPVLWVSNLLLLIIQASITYLSCHFDCYWDFCLTIDQELRGX

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-292 L domain-like,LRR

XRXXEKRPQAGSAITAGTNIPSGFGSSLEELVFIENPALIGPVDRIIGNFTNLRRLVLSGTGVSGNIPESVGDLVSLQEISLSRNRLSGGVPLNLTKLEKLRILDLSYNGLDRNVPVSIGNLTELLKLDLSFNGFSGEIPDSLGRLQSLEFLDLSFNRFGNYGVPLFLADMPRLRDVYLSGNSLGGQIPRIWENLGGILGIGFSNMGLVGSIPASMGMHLRNLCYLRLDNNKLEGQVPEELGLLKNANEINLENNNLSGRIPFSAQFRTRIGEKLKLSGNPGLCFDEKQNFP

Gene3D: G3DSA:3.80.10.10
19-104 no description

NIPSGFGSSLEELVFIENPALIGPVDRIIGNFTNLRRLVLSGTGVSGNIPESVGDLVSLQEISLSRNRLSGGVPLNLTKLEKLRIL

HMMPanther: PTHR24420
20-284 FAMILY NOT NAMED,FAMILY NOT NAMED

IPSGFGSSLEELVFIENPALIGPVDRIIGNFTNLRRLVLSGTGVSGNIPESVGDLVSLQEISLSRNRLSGGVPLNLTKLEKLRILDLSYNGLDRNVPVSIGNLTELLKLDLSFNGFSGEIPDSLGRLQSLEFLDLSFNRFGNYGVPLFLADMPRLRDVYLSGNSLGGQIPRIWENLGGILGIGFSNMGLVGSIPASMGMHLRNLCYLRLDNNKLEGQVPEELGLLKNANEINLENNNLSGRIPFSAQFRTRIGEKLKLSGNPGLC

HMMSmart: SM00369
IPR003591
98-122 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LEKLRILDLSYNGLDRNVPVSIGNL

HMMPfam: PF13855
100-159 LRR_8,Leucine rich repeat

KLRILDLSYNGLDRNVPVSIGNLTELLKLDLSFNGFSGEIPDSLGRLQSLEFLDLSFNRF

Gene3D: G3DSA:3.80.10.10
105-312 no description

DLSYNGLDRNVPVSIGNLTELLKLDLSFNGFSGEIPDSLGRLQSLEFLDLSFNRFGNYGVPLFLADMPRLRDVYLSGNSLGGQIPRIWENLGGILGIGFSNMGLVGSIPASMGMHLRNLCYLRLDNNKLEGQVPEELGLLKNANEINLENNNLSGRIPFSAQFRTRIGEKLKLSGNPGLCFDEKQNFPKKGNSRLEQFKLCNNTGTLN

HMMSmart: SM00369
IPR003591
146-169 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LQSLEFLDLSFNRFGNYGVPLFLA

HMMSmart: SM00369
IPR003591
171-194 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MPRLRDVYLSGNSLGGQIPRIWEN

HMMSmart: SM00369
IPR003591
220-244 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LRNLCYLRLDNNKLEGQVPEELGLL

Seg: seg
243-257 seg

LLKNANEINLENNNL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox