PRGDB00079621 (Cpp.2039)

From PRG Wiki
Jump to: navigation, search
Cpp.2039
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 186788412 (EX274306)
Gene Class Unknown
Domain Type
Gene Species Arabidopsis lyrata subsp. lyrata

Comment?

1455395_5_E17_075 PY06 Carica papaya cDNA, mRNA sequence

DNA Sequence

CCCCTAGCTTTTTGGTCCTGACGGCATCCCGGGATCGGCCATTACGGCCGGGGGATTGGTATTGTCTGTGCAAGTCCCAAGGCTCTGGAGGCATCCAAAACGGCAAAATCAGTCAGAGTTTTCTTTGACTGGGCTGATTACTTGAAATTCTATAAGTTAGGAACATATTGGCCCTATACCCCTTCTATCCAATTGCTTTATGGGTTGAGAGCAGCTCTGGACCTCATCTTTGAGGAAGGACTTGAGAATATCATCGAAAGGCATGCCCGTTTGGGAAAAGCAACAAGGCTGGCTGTGGAAGCATGGGGATTGAAGGACTGCACACAGAAGGAGGAATGGTACAGTAACACAGTTACTGCTGTGCTTGTTCCTCCTTATATCGATAGCAGTGAAATTGTTAGAAGAGCATGGAAGAGATACAATCTAAGCTTAGGTCTTGGTCTCAACAAAGTAGCTGGAAAAGTGTTCAGAAGGGGGCCATCTTGGCAACTTGAATGAGCTGCAACTGCTGGGTTGTCTTGCTGGTGTTGAGATGATATTGAAGGATGTTGGGTACCCCAGTTAAACTTGGAAGTGGGAGTTGGCAGCTGGCTTTGTGGGCATATTTTGCCAGAAATAACAATCCCTCTCCCATTTCCTTTCCCAGGGATTTAAATTGGGTAACTAATAATTCCACCCTTTTCCTCTTTGTAAAAAATTTAAATCAATTCTccccccccctcccccccATTCTTGGCTTTTGAACCCTCCTTGCGCCAAATTTTTCCTTGCCTTAAATACCTTAAAAACCCCCCTGGGATTCCCTTTATACTCTTTTCCCGAAAAAAAGCTGAAGGAAATACATCATCATAAACCaaaaaaataaataatacaaaaaagaaaaaaatttttaaaaaaaaaaaaaGGGGGGGCGCTTGGGGTCTTAAAAAACTTTCTCTAAACACCTTCTCTTGTGGGCGCGGGCGCGCCCCCAAGAGGGGAGAGAGCACGGGGGGGCACACGCTGGTCTCCCAGAGAGAACACCCGCGCAAAGAAACAGAGGCTGTTGTATTCTTCCTCCACaaaaaaaaaaaaCACCCCCGCGGGGGAGCCACCC


Protein sequences

Name Description Sequence
Cpp.2039 translated coding region predicted by ESTScan from UniGene Cpp.2039

PLAFWSXRHPGIGHYGRGIGIVCASPKALEASKTAKSVRVFFDWADYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIERHARLGKATRLAVEAWGLKDCTQKEEWYSNTVTAVLVPPYIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRRGPSWQLEXAATAGLSCWCXDDIEGCWVPQLNLEVGVGSWLCGHILPEITIPLPFPFPGI

Domains

Domain Start-End Description Sequence

superfamily: SSF53383
IPR015424
16-163 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

GRGIGIVCASPKALEASKTAKSVRVFFDWADYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIERHARLGKATRLAVEAWGLKDCTQKEEWYSNTVTAVLVPPYIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRRGPSWQ

Gene3D: G3DSA:3.40.640.10
IPR015421
16-67 no description
Pyridoxal phosphate-dependent transferase, major r

GRGIGIVCASPKALEASKTAKSVRVFFDWADYLKFYKLGTYWPYTPSIQLLY

HMMPfam: PF00266
IPR000192
17-134 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

RGIGIVCASPKALEASKTAKSVRVFFDWADYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIERHARLGKATRLAVEAWGLKDCTQKEEWYSNTVTAVLVPPYIDSSEIVR

HMMPanther: PTHR21152:SF7
18-157 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

GIGIVCASPKALEASKTAKSVRVFFDWADYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIERHARLGKATRLAVEAWGLKDCTQKEEWYSNTVTAVLVPPYIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFR

HMMPanther: PTHR21152
18-157 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

GIGIVCASPKALEASKTAKSVRVFFDWADYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIERHARLGKATRLAVEAWGLKDCTQKEEWYSNTVTAVLVPPYIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFR

Gene3D: G3DSA:3.90.1150.10
IPR015422
68-157 no description
Pyridoxal phosphate-dependent transferase, major r

GLRAALDLIFEEGLENIIERHARLGKATRLAVEAWGLKDCTQKEEWYSNTVTAVLVPPYIDSSEIVRRAWKRYNLSLGLGLNKVAGKVFR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox