PRGDB00079622 (Cpp.2124)

From PRG Wiki
Jump to: navigation, search
Cpp.2124
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 186780928 (EX248273)
Gene Class Unknown
Domain Type LRR
Gene Species Arabidopsis lyrata subsp. lyrata

Comment?

PY04049X1F12.f1 PY04 Carica papaya cDNA, mRNA sequence

DNA Sequence

GCACGAGGGTCCGGCGAAATCCCGGATCAGATCGGAAATCTTCAGAAGCTCACCGTGCTCAACCTCGCTGATAACGAGATCTCCGGCAAGATCCCGGCATCTCTGGTGTGTCTCTCCGATTTACGGCATCTCGACTTGAGCAACAACAAGCTCACCGGAAAAATGCCCAACGAGTTCGGGAACATGAAGATGCTGAGTCGAGCACTACTGAGTCGAAACCAGCTAACAGGGACGATTCCGTGTTCAGTGACCGGAATGTACAGGTTGGCAGACTTGGATCTGGCCATGAATAGGATCTCTGGTACGATACCGGAGCAGATGGGGAAAATGCCTGTACTATCAACCCTGACCCTAGATGGTAACATGCTTGTGGGTGAAATACCAGGTGATTTGCTGGGTAATCCCGGGTTGGGTATCTTGAATCTGAGCAGAAACGGGTTGGAAGGAAACATACCGGATGTATTTGGACCGAAATCGTACTTCATGGCGCTCGATTTATCGTATAATAATTTGA


Protein sequences

Name Description Sequence
Cpp.2124 translated coding region predicted by ESTScan from UniGene Cpp.2124

ARGSGEIPDQIGNLQKLTVLNLADNEISGKIPASLVCLSDLRHLDLSNNKLTGKMPNEFGNMKMLSRALLSRNQLTGTIPCSVTGMYRLADLDLAMNRISGTIPEQMGKMPVLSTLTLDGNMLVGEIPGDLLGNPGLGILNLSRNGLEGNIPDVFGPKSYFMALDLSYNNLX


Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
4-171 no description

SGEIPDQIGNLQKLTVLNLADNEISGKIPASLVCLSDLRHLDLSNNKLTGKMPNEFGNMKMLSRALLSRNQLTGTIPCSVTGMYRLADLDLAMNRISGTIPEQMGKMPVLSTLTLDGNMLVGEIPGDLLGNPGLGILNLSRNGLEGNIPDVFGPKSYFMALDLSYNNL

superfamily: SSF52058
4-171 L domain-like,LRR

SGEIPDQIGNLQKLTVLNLADNEISGKIPASLVCLSDLRHLDLSNNKLTGKMPNEFGNMKMLSRALLSRNQLTGTIPCSVTGMYRLADLDLAMNRISGTIPEQMGKMPVLSTLTLDGNMLVGEIPGDLLGNPGLGILNLSRNGLEGNIPDVFGPKSYFMALDLSYNNL

HMMPanther: PTHR24420:SF701
5-171 DRT100 (DNA-DAMAGE REPAIR/TOLERATION 100); PROTEIN BINDING

GEIPDQIGNLQKLTVLNLADNEISGKIPASLVCLSDLRHLDLSNNKLTGKMPNEFGNMKMLSRALLSRNQLTGTIPCSVTGMYRLADLDLAMNRISGTIPEQMGKMPVLSTLTLDGNMLVGEIPGDLLGNPGLGILNLSRNGLEGNIPDVFGPKSYFMALDLSYNNL

HMMPanther: PTHR24420
5-171 FAMILY NOT NAMED,FAMILY NOT NAMED

GEIPDQIGNLQKLTVLNLADNEISGKIPASLVCLSDLRHLDLSNNKLTGKMPNEFGNMKMLSRALLSRNQLTGTIPCSVTGMYRLADLDLAMNRISGTIPEQMGKMPVLSTLTLDGNMLVGEIPGDLLGNPGLGILNLSRNGLEGNIPDVFGPKSYFMALDLSYNNL

HMMPfam: PF12799
16-52 LRR_4,Leucine Rich repeats (2 copies)

KLTVLNLADNEISGKIPASLVCLSDLRHLDLSNNKLT

FPrintScan: PR00019
17-30 LEURICHRPT,Leucine-rich repeat signature

LTVLNLADNEISGK

FPrintScan: PR00019
38-51 LEURICHRPT,Leucine-rich repeat signature

LSDLRHLDLSNNKL

Seg: seg
127-142 seg

IPGDLLGNPGLGILNL

HMMPfam: PF00560
IPR001611
139-155 LRR_1
Leucine-rich repeat

ILNLSRNGLEGNIPDVF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox