PRGDB00079623 (Cpp.2129)

From PRG Wiki
Jump to: navigation, search
Cpp.2129
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 186737463 (EX262394)
Gene Class Unknown
Domain Type
Gene Species Arabidopsis lyrata subsp. lyrata

Comment?

1442666_5_C08_030 PY06 Carica papaya cDNA, mRNA sequence

DNA Sequence

CCCCCTTCTGTTATTCGGCTGCGGGAGTCGGCCATTACGGCCGGGGACGCGAAAACAGAATCTGTGCGAGCGAAAAAACGAAAATGAACAGTGGCGAAGGCAAGACCGTCTGCGTCACCGGAGCCTCCGGTTACATAGCTTCATGGATCGTCAACCTCCTCCTCCTCCGTGGCTACACTGTCAAGGCCTCTGTTCGCGACCCAAATGATCCAAGAAAGACTGAGCACTTGCTTGGACTGGAAGGTGCTAGGGAAAGATTGCAACTGTTTAAAGCAAACCTATTAGAAGAAAGCTCTTTTGACTCTGTTATTGATGGATGCGAAGGTGTCTTTCATACAGCATCTCCCTTCTACCATGATGTTAAGGACCCACAGGTTGAGTTACTAGACCCTGCAGTAAAGGGAACCCTTAATGTTCTCAACTCCTGTGCAAAGACCTCTTCTGTCAGACGAGTTGTTTTAACATCTTCTATAGCTGCTGTTGCTTTCAACGGAAAACCTCGAACTCCAGCAACAGTAGTTGATGAAACTTGGTTTTCTGATCCAGACTTTTGCCGATCATCAAAGCTGTGGTACGTGCTTTCAAAAACCTTGGCTGAAGATTCTGCCTGGAAATTTGCAAAAGAGAAGGGTATGGAACTGGTTACCATAAACCCAGCAATGGTGATTGGTCCTCTCTTACAGCCAACTCTTAATACCAGTGCTGCAGCAGTTTTAAGCTTAATTAAAGGAGCACATACCTTCCCGAATGCAACTTTTGGATGGGTCAATGTTAAAGATGTTGCTAATGCACATATTCAAGCATTTGAAATTCCATCAGCCAGTGGAAGATATTGTTTGGTTGAGAGAGTTGCACATTATTCGGAAGTTGTGAAGATTTTACGCCAGTACTACCCTGCTTTCCAACTTCCAGAGAAGTGTGCAGATGACAAGCCATATGTGCCGACATATCAGTGTCGAAAGAAAGAGCAAAGAGCTGGGTATTGAGTTCATTCCATTGAAGTGAGCATCAGAAACAGTTGAGACGTTGAGAAAAGGATTGTGCAGTCTGAGTCTTTTCTTATTATAGTTTGTTTGGAAATAAAATGACGGTGACCTCCTATCAAACCTTTTGTCTTTATGCTGGGTGCT


Protein sequences

Name Description Sequence
Cpp.2129 translated coding region predicted by ESTScan from UniGene Cpp.2129

XPFCYSAAGVGHYGRGRENRICASEKTKMNSGEGKTVCVTGASGYIASWIVNLLLLRGYTVKASVRDPNDPRKTEHLLGLEGARERLQLFKANLLEESSFDSVIDGCEGVFHTASPFYHDVKDPQVELLDPAVKGTLNVLNSCAKTSSVRRVVLTSSIAAVAFNGKPRTPATVVDETWFSDPDFCRSSKLWYVLSKTLAEDSAWKFAKEKGMELVTINPAMVIGPLLQPTLNTSAAAVLSLIKGAHTFPNATFGWVNVKDVANAHIQAFEIPSASGRYCLVERVAHYSEVVKILRQYYPAFQLPEKCADDKPYVPTYQCRKKEQRAGY

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10366:SF9
19-318 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

NRICASEKTKMNSGEGKTVCVTGASGYIASWIVNLLLLRGYTVKASVRDPNDPRKTEHLLGLEGARERLQLFKANLLEESSFDSVIDGCEGVFHTASPFYHDVKDPQVELLDPAVKGTLNVLNSCAKTSSVRRVVLTSSIAAVAFNGKPRTPATVVDETWFSDPDFCRSSKLWYVLSKTLAEDSAWKFAKEKGMELVTINPAMVIGPLLQPTLNTSAAAVLSLIKGAHTFPNATFGWVNVKDVANAHIQAFEIPSASGRYCLVERVAHYSEVVKILRQYYPAFQLPEKCADDKPYVPTYQ

HMMPanther: PTHR10366
19-318 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

NRICASEKTKMNSGEGKTVCVTGASGYIASWIVNLLLLRGYTVKASVRDPNDPRKTEHLLGLEGARERLQLFKANLLEESSFDSVIDGCEGVFHTASPFYHDVKDPQVELLDPAVKGTLNVLNSCAKTSSVRRVVLTSSIAAVAFNGKPRTPATVVDETWFSDPDFCRSSKLWYVLSKTLAEDSAWKFAKEKGMELVTINPAMVIGPLLQPTLNTSAAAVLSLIKGAHTFPNATFGWVNVKDVANAHIQAFEIPSASGRYCLVERVAHYSEVVKILRQYYPAFQLPEKCADDKPYVPTYQ

superfamily: SSF51735
29-309 NAD(P)-binding Rossmann-fold domains

MNSGEGKTVCVTGASGYIASWIVNLLLLRGYTVKASVRDPNDPRKTEHLLGLEGARERLQLFKANLLEESSFDSVIDGCEGVFHTASPFYHDVKDPQVELLDPAVKGTLNVLNSCAKTSSVRRVVLTSSIAAVAFNGKPRTPATVVDETWFSDPDFCRSSKLWYVLSKTLAEDSAWKFAKEKGMELVTINPAMVIGPLLQPTLNTSAAAVLSLIKGAHTFPNATFGWVNVKDVANAHIQAFEIPSASGRYCLVERVAHYSEVVKILRQYYPAFQLPEKCAD

Gene3D: G3DSA:3.40.50.720
IPR016040
35-261 no description
NAD(P)-binding domain

KTVCVTGASGYIASWIVNLLLLRGYTVKASVRDPNDPRKTEHLLGLEGARERLQLFKANLLEESSFDSVIDGCEGVFHTASPFYHDVKDPQVELLDPAVKGTLNVLNSCAKTSSVRRVVLTSSIAAVAFNGKPRTPATVVDETWFSDPDFCRSSKLWYVLSKTLAEDSAWKFAKEKGMELVTINPAMVIGPLLQPTLNTSAAAVLSLIKGAHTFPNATFGWVNVKDV

HMMPfam: PF01370
IPR001509
37-273 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGASGYIASWIVNLLLLRGYTVKASVRDPNDPRKTEHLLGLEGARERLQLFKANLLEESSFDSVIDGCEGVFHTASPFYHDVKDPQVELLDPAVKGTLNVLNSCAKTSSVRRVVLTSSIAAVAFNGKPRTPATVVDETWFSDPDFCRSSKLWYVLSKTLAEDSAWKFAKEKGMELVTINPAMVIGPLLQPTLNTSAAAVLSLIKGAHTFPNATFGWVNVKDVANAHIQAFEIPS

Seg: seg
146-157 seg

TSSVRRVVLTSS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox