PRGDB00079625 (Cpp.2197)

From PRG Wiki
Jump to: navigation, search
Cpp.2197
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 186826569 (EX269647)
Gene Class Unknown
Domain Type
Gene Species Arabidopsis lyrata subsp. lyrata

Comment?

1450014_5_E12_044 PY06 Carica papaya cDNA, mRNA sequence

DNA Sequence

ATTCCGGGCCCTTTACGTGCCTGGGGGGACCATTATATATGATATACATAAACCGCCTCTTGCCTATGAAAAGGTGTGTTTTAAAGTGGTATTTTCCTAaagaagaacaagaagaagaagaagaaagaTAATGGACATTGCACATTTCTTGTTTGGTATTTTTGGAAATGCAATTGCTTTGTTCCTCTTCTTGGCTCCAACGATCACATTAAAGATGATCATATCTAGTATGTCGACTCAGCTATTTTCTTGTATTCCTTACGAAATGACTTTGCTCAAATGACTCCTTTCTGCTTGGTATGGTCTTCCATTTGTGTCTAAAAACAACCTTTTAGAATCAACGATATTTGGGACAGGATCAGTGATAGAAGGGATTTATGTCTTGTTGTTTCTGATATTTGCTCCGAAGAAGGAAAAGGCTAAAATATTTGGGCTTCTGGAGCTCGTGCTTTCTGTCTTCTCCACTGTGGCTTTGGTGTCTCTGCTTGCCCTTCATGGCACCACCAGAAAGCTCTTTTGTGGCCTTGCTGCCACCATTTTCTCCATTATCATGTACGCGTCTCCTCTGTCAATTATGAGGTTGGTGATTAGAACAAAGAGCGTGGAGTTCATGCCTTTCTTCTTATCACTGTTTGTGTTCTTGTGTGGTACTTCCTGGTTTGTGTACGGTCTTCTTGGTCGTGACCCTTTTGTTGCTATTCCAAATGGGTTTGGGTGTGCACTGGGGACAGCGCAGCTCATATTGTATTTCATATACCACAATAATCAATCTGCGGCAGAGAAAGCAAGTGATGAGAAATGTGTGGAGATGGGAGCTGGCAATGGCAATATCTATTGAAAACAACCCTGCCGGGTGAATCTCGGCTGTTTAAGTCTTCTACTTTGTCTTCTTTTTGGTGGGATAAGATTTGCCCATTCGAGTATTCTGAAAGATGGGTTTCTTGTATTGCAGATAAAGGGGGGGTTTTCATATCTAGAATTCCTTTTTTGTTATTTTCACCTTTTAAACATATACTTAATGTGTGCGTACGTGTGGCATGCTAATTTGTTCTTCTTGATTGGAAACTGGTTATTACTTTCTA


Protein sequences

Name Description Sequence
Cpp.2197 translated coding region predicted by ESTScan from UniGene Cpp.2197

MDIAHFLFGIFGNAIALFLFLAPTITLKMIISSMSTQLFSCIPYEMTLLKXLLSAWYGLPFVSKNNLLESTIFGTGSVIEGIYVLLFLIFAPKKEKAKIFGLLELVLSVFSTVALVSLLALHGTTRKLFCGLAATIFSIIMYASPLSIMRLVIRTKSVEFMPFFLSLFVFLCGTSWFVYGLLGRDPFVAIPNGFGCALGTAQLILYFIYHNNQSAAEKASDEKCVEMGAGNGNIY


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10791
IPR004316
6-209 RAG1-ACTIVATING PROTEIN 1
RAG1-activating protein-1-related

FLFGIFGNAIALFLFLAPTITLKMIISSMSTQLFSCIPYEMTLLKXLLSAWYGLPFVSKNNLLESTIFGTGSVIEGIYVLLFLIFAPKKEKAKIFGLLELVLSVFSTVALVSLLALHGTTRKLFCGLAATIFSIIMYASPLSIMRLVIRTKSVEFMPFFLSLFVFLCGTSWFVYGLLGRDPFVAIPNGFGCALGTAQLILYFIY

HMMPfam: PF03083
IPR004316
7-94 MtN3_slv
RAG1-activating protein-1-related

LFGIFGNAIALFLFLAPTITLKMIISSMSTQLFSCIPYEMTLLKXLLSAWYGLPFVSKNNLLESTIFGTGSVIEGIYVLLFLIFAPKK

HMMPfam: PF03083
IPR004316
130-213 MtN3_slv
RAG1-activating protein-1-related

CGLAATIFSIIMYASPLSIMRLVIRTKSVEFMPFFLSLFVFLCGTSWFVYGLLGRDPFVAIPNGFGCALGTAQLILYFIYHNNQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox