PRGDB00079626 (Cpp.2265)

From PRG Wiki
Jump to: navigation, search
Cpp.2265
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 186825329 (EX259034)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis lyrata subsp. lyrata

Comment?

1439453_5_M11_036 PY06 Carica papaya cDNA, mRNA sequence

DNA Sequence

GCCGAAATGCCCGGGGATTCGGGCCATTACGGCCGGGGACAGAGATGGTGCGGTGTCGTCCCCGACGCGTGGTTTTCTCCCATTTGCCCTTCTCTCTCCCGCCTGATTGATATCTACACTTCCAACCTGCGAATTTGGAGCTGCTGCCTCCTGTATTGTTATTGTGGCCATTAAGCAACTCAATCCTGAGGGTCTCCAGGGTAATCAGGAATTCATTGTGGAGGTTCTCATGCTGAGCCTATTGCATCATGCCAATCTTGTTACACTGATTGGTTACTGTACTGCTGGAGATCAAAGGCTATTAGTTTATGAATATATGCCAAGGGGTAGTTTGGAAGATCACCTTTTTGATCTTGAACCTGGTCAAGAAGAGCCTCTTAATTGGAACACTCGCATTAAGATTGCAGTTGGTGCTGCTCGTGGTATTGAGTATCTTCACTGCAGAGCTGAGCGGCCAGTTATTTATCGTGATCTAAAGTCAGCAAATATTTTACTGGATGATGAATTCAACCCCAAAACTCTCAGACTTTGGACTTGCCAAGTTGGCTCCTGTTGGTGACAAAACACATGTTTTCAACCAGGGTGATGGGAACTTATGGATACTGCGCTCCTGATTATGCGATGAGTGGCAAATTTGACTCTTAATCAGATATTTATAGCTTTGGTGTGGTATTGCTAGAGTTGATATCTGGGCGGAAGGCTATAGATCTAACTAAAGGCGTGGAGAGCAGAACCTTGTTGCTTGTCTCGTCCTTTTCTCAAGGATCAGAAGAAGTATGGCTACCTGGTTGATCCTCTCATGCAAGTGACGCTTTTCTCGTCGTTGACTGAGACTATGCAATTGCAATAACTTGCAATGTGTCTTAATGAGGAAGCTAAATTTCCGGCTTCTATTAGCCGATATTCGTTATTGCACTGGAATATTTGGCATCCCGGAGTACCACCCCTGATTCTGTTTGAAGCCGGCGTGCTTCCATGCTCCTTCCGCCTAAAT


Protein sequences

Name Description Sequence
Cpp.2265 translated coding region predicted by ESTScan from UniGene Cpp.2265

XPKCPGIRAITAGDRDGAVSSPTRGFLPFALLSPAXLISTLPTCEFGAAASCIVIVAIKQLNPEGLQGNQEFIVEVLMLSLLHHANLVTLIGYCTAGDQRLLVYEYMPRGSLEDHLFDLEPGQEEPLNWNTRIKIAVGAARGIEYLHCRAERPVIYRDLKSANILLDDXIQPQNSQTLDLPSWLLLVTKHMFSTRVMGTYGYCAPDYAMSGKFDSXSDIYSFGVVLLELISGRKAIDLTKGVESRTLLLVSSFSQGSEEVWLPGXSSHASDAFLVVD

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-277 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XPKCPGIRAITAGDRDGAVSSPTRGFLPFALLSPAXLISTLPTCEFGAAASCIVIVAIKQLNPEGLQGNQEFIVEVLMLSLLHHANLVTLIGYCTAGDQRLLVYEYMPRGSLEDHLFDLEPGQEEPLNWNTRIKIAVGAARGIEYLHCRAERPVIYRDLKSANILLDDXIQPQNSQTLDLPSWLLLVTKHMFSTRVMGTYGYCAPDYAMSGKFDSXSDIYSFGVVLLELISGRKAIDLTKGVESRTLLLVSSFSQGSEEVWLPGXSSHASDAFLVVD

Seg: seg
26-39 seg

FLPFALLSPAXLIS

HMMSmart: SM00219
IPR020635
35-260 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

AXLISTLPTCEFGAAASCIVIVAIKQLNPEGLQGNQEFIVEVLMLSLLHHANLVTLIGYCTAGDQRLLVYEYMPRGSLEDHLFDLEPGQEEPLNWNTRIKIAVGAARGIEYLHCRAERPVIYRDLKSANILLDDXIQPQNSQTLDLPSWLLLVTKHMFSTRVMGTYGYCAPDYAMSGKFDSXSDIYSFGVVLLELISGRKAIDLTKGVESRTLLLVSSFSQGSEEV

HMMSmart: SM00220
IPR002290
38-274 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

ISTLPTCEFGAAASCIVIVAIKQLNPEGLQGNQEFIVEVLMLSLLHHANLVTLIGYCTAGDQRLLVYEYMPRGSLEDHLFDLEPGQEEPLNWNTRIKIAVGAARGIEYLHCRAERPVIYRDLKSANILLDDXIQPQNSQTLDLPSWLLLVTKHMFSTRVMGTYGYCAPDYAMSGKFDSXSDIYSFGVVLLELISGRKAIDLTKGVESRTLLLVSSFSQGSEEVWLPGXSSHASDAFL

superfamily: SSF56112
IPR011009
54-237 Protein kinase-like (PK-like)
Protein kinase-like domain

VIVAIKQLNPEGLQGNQEFIVEVLMLSLLHHANLVTLIGYCTAGDQRLLVYEYMPRGSLEDHLFDLEPGQEEPLNWNTRIKIAVGAARGIEYLHCRAERPVIYRDLKSANILLDDXIQPQNSQTLDLPSWLLLVTKHMFSTRVMGTYGYCAPDYAMSGKFDSXSDIYSFGVVLLELISGRKAID

HMMPfam: PF00069
IPR017442
55-237 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

IVAIKQLNPEGLQGNQEFIVEVLMLSLLHHANLVTLIGYCTAGDQRLLVYEYMPRGSLEDHLFDLEPGQEEPLNWNTRIKIAVGAARGIEYLHCRAERPVIYRDLKSANILLDDXIQPQNSQTLDLPSWLLLVTKHMFSTRVMGTYGYCAPDYAMSGKFDSXSDIYSFGVVLLELISGRKAID

Gene3D: G3DSA:3.30.200.20
55-99 no description

IVAIKQLNPEGLQGNQEFIVEVLMLSLLHHANLVTLIGYCTAGDQ

HMMPanther: PTHR24420:SF700
55-247 SUBFAMILY NOT NAMED

IVAIKQLNPEGLQGNQEFIVEVLMLSLLHHANLVTLIGYCTAGDQRLLVYEYMPRGSLEDHLFDLEPGQEEPLNWNTRIKIAVGAARGIEYLHCRAERPVIYRDLKSANILLDDXIQPQNSQTLDLPSWLLLVTKHMFSTRVMGTYGYCAPDYAMSGKFDSXSDIYSFGVVLLELISGRKAIDLTKGVESRTL

HMMPanther: PTHR24420
55-247 FAMILY NOT NAMED,FAMILY NOT NAMED

IVAIKQLNPEGLQGNQEFIVEVLMLSLLHHANLVTLIGYCTAGDQRLLVYEYMPRGSLEDHLFDLEPGQEEPLNWNTRIKIAVGAARGIEYLHCRAERPVIYRDLKSANILLDDXIQPQNSQTLDLPSWLLLVTKHMFSTRVMGTYGYCAPDYAMSGKFDSXSDIYSFGVVLLELISGRKAIDLTKGVESRTL

Gene3D: G3DSA:1.10.510.10
100-237 no description

RLLVYEYMPRGSLEDHLFDLEPGQEEPLNWNTRIKIAVGAARGIEYLHCRAERPVIYRDLKSANILLDDXIQPQNSQTLDLPSWLLLVTKHMFSTRVMGTYGYCAPDYAMSGKFDSXSDIYSFGVVLLELISGRKAID

PatternScan: PS00108
IPR008271
154-166 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIYRDLKSANILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox