PRGDB00079628 (Cpp.2355)

From PRG Wiki
Jump to: navigation, search
Cpp.2355
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 186808340 (EX302119)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis lyrata subsp. lyrata

Comment?

1617051_5_I09_039 PY06 Carica papaya cDNA, mRNA sequence

DNA Sequence

GCCCGGGCGGGGCGGGGGATCGGCATTACGGCCGGGGAAAGAAGAGGCTCAAATGATGCTAAAAATTTGGTGAAAACCCTAAGTGACAGTAGCTTGAACTTCAAGTACTCTATACTAGAGAAGGCTACAGGATCATTTGCCGAGGCCAACAAGCTTGGACAAGGAGGATTTGGGACAGTCTATAAAGGAATCCTTCCTGATGGAAGAGAGATTGCCGTTAAGAGGCTTTTCTTTAACAACAGACATAGAGCAGCAGATTTCTACAATGAAGTAAACATCATCAGCAGCGTGGAACACAAGAATCTGGTCAGGCTGTTGGGATGCAGTTGTTCAGGACCTGAAAGCCTTCTTGTTTATGAATACCTGCCTAATAAGAGTCTTGATCGTTTCATCTTTGATGCAACCAGAGGTAAAACACTTAACTGGGAGCAGAGATACCAGATTATTATTGGGACTGCAGAAGGTCTAGTTTACCTTCATGAGAACTCCAATGTTAGAATCATTCACAGGGACATAAAGGCCAGTAATATCTTGTTAGACTCAAAACTCCGGGCTAGGATTGCTGATTTTGGGGTTGGCGAGATCTTTCCAGGAGGACAAGAGTCACATCAGCACAGCTATTGCCGGCACCCTAGGGATATATGGCTCCAGAGTACCTAGCCCATGGCCAATTAACGGAAAAGGCAGACGTCTATAGCTTTGGTGTCCTTCTGTTGGAGGATTATCACAGCGAAGCAAACAGCGGTAGCAAAACCTCAGTTATACCGACAACCTTGGTGGCATTAACGTGGCAAGCATTTCAGCAGGCAGAGTTGGAGGACTTCATTGACCCAATCTATGTTATAAACTTTCCACAATGGAACACGTTAAGATGGAGCATTTATAAGCGGTGGCATATCGGACTTCCTGTGGGCTCCAAGAGATTACAATCGATGGCAACTATAATTGGTCAAAGGCCCTGGCGATGGTTACCAGGAGAGGGGTGTAGACTC


Protein sequences

Name Description Sequence
Cpp.2355 translated coding region predicted by ESTScan from UniGene Cpp.2355

ARAGRGIGITAGERRGSNDAKNLVKTLSDSSLNFKYSILEKATGSFAEANKLGQGGFGTVYKGILPDGREIAVKRLFFNNRHRAADFYNEVNIISSVEHKNLVRLLGCSCSGPESLLVYEYLPNKSLDRFIFDATRGKTLNWEQRYQIIIGTAEGLVYLHENSNVRIIHRDIKASNILLDSKLRARIADFGVGEIFPGGQESHQHSYCRHPXGYMAPEYLAHGQLTEKADVYSFGVLLLEDYHSEANSGSKTSVIPTTLVALTWQAFQQAELEDFIDPIYVINFPQWNTLRWSIYKRWHIGLPVGSKRLQSMATIIGQRPWRWLPGEGCRL

Domains

Domain Start-End Description Sequence

Seg: seg
1-16 seg

ARAGRGIGITAGERRG

superfamily: SSF56112
IPR011009
18-240 Protein kinase-like (PK-like)
Protein kinase-like domain

NDAKNLVKTLSDSSLNFKYSILEKATGSFAEANKLGQGGFGTVYKGILPDGREIAVKRLFFNNRHRAADFYNEVNIISSVEHKNLVRLLGCSCSGPESLLVYEYLPNKSLDRFIFDATRGKTLNWEQRYQIIIGTAEGLVYLHENSNVRIIHRDIKASNILLDSKLRARIADFGVGEIFPGGQESHQHSYCRHPXGYMAPEYLAHGQLTEKADVYSFGVLLLE

HMMPanther: PTHR24420:SF433
28-279 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

SDSSLNFKYSILEKATGSFAEANKLGQGGFGTVYKGILPDGREIAVKRLFFNNRHRAADFYNEVNIISSVEHKNLVRLLGCSCSGPESLLVYEYLPNKSLDRFIFDATRGKTLNWEQRYQIIIGTAEGLVYLHENSNVRIIHRDIKASNILLDSKLRARIADFGVGEIFPGGQESHQHSYCRHPXGYMAPEYLAHGQLTEKADVYSFGVLLLEDYHSEANSGSKTSVIPTTLVALTWQAFQQAELEDFIDPI

HMMPanther: PTHR24420
28-279 FAMILY NOT NAMED,FAMILY NOT NAMED

SDSSLNFKYSILEKATGSFAEANKLGQGGFGTVYKGILPDGREIAVKRLFFNNRHRAADFYNEVNIISSVEHKNLVRLLGCSCSGPESLLVYEYLPNKSLDRFIFDATRGKTLNWEQRYQIIIGTAEGLVYLHENSNVRIIHRDIKASNILLDSKLRARIADFGVGEIFPGGQESHQHSYCRHPXGYMAPEYLAHGQLTEKADVYSFGVLLLEDYHSEANSGSKTSVIPTTLVALTWQAFQQAELEDFIDPI

Gene3D: G3DSA:3.30.200.20
30-107 no description

SSLNFKYSILEKATGSFAEANKLGQGGFGTVYKGILPDGREIAVKRLFFNNRHRAADFYNEVNIISSVEHKNLVRLLG

ProfileScan: PS50011
IPR000719
46-331 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FAEANKLGQGGFGTVYKGILPDGREIAVKRLFFNNRHRAADFYNEVNIISSVEHKNLVRLLGCSCSGPESLLVYEYLPNKSLDRFIFDATRGKTLNWEQRYQIIIGTAEGLVYLHENSNVRIIHRDIKASNILLDSKLRARIADFGVGEIFPGGQESHQHSYCRHPXGYMAPEYLAHGQLTEKADVYSFGVLLLEDYHSEANSGSKTSVIPTTLVALTWQAFQQAELEDFIDPIYVINFPQWNTLRWSIYKRWHIGLPVGSKRLQSMATIIGQRPWRWLPGEGCRL

HMMSmart: SM00220
IPR002290
46-293 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FAEANKLGQGGFGTVYKGILPDGREIAVKRLFFNNRHRAADFYNEVNIISSVEHKNLVRLLGCSCSGPESLLVYEYLPNKSLDRFIFDATRGKTLNWEQRYQIIIGTAEGLVYLHENSNVRIIHRDIKASNILLDSKLRARIADFGVGEIFPGGQESHQHSYCRHPXGYMAPEYLAHGQLTEKADVYSFGVLLLEDYHSEANSGSKTSVIPTTLVALTWQAFQQAELEDFIDPIYVINFPQWNTLRWS

HMMSmart: SM00219
IPR020635
46-294 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FAEANKLGQGGFGTVYKGILPDGREIAVKRLFFNNRHRAADFYNEVNIISSVEHKNLVRLLGCSCSGPESLLVYEYLPNKSLDRFIFDATRGKTLNWEQRYQIIIGTAEGLVYLHENSNVRIIHRDIKASNILLDSKLRARIADFGVGEIFPGGQESHQHSYCRHPXGYMAPEYLAHGQLTEKADVYSFGVLLLEDYHSEANSGSKTSVIPTTLVALTWQAFQQAELEDFIDPIYVINFPQWNTLRWSI

HMMPfam: PF07714
IPR001245
50-244 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

NKLGQGGFGTVYKGILPDGREIAVKRLFFNNRHRAADFYNEVNIISSVEHKNLVRLLGCSCSGPESLLVYEYLPNKSLDRFIFDATRGKTLNWEQRYQIIIGTAEGLVYLHENSNVRIIHRDIKASNILLDSKLRARIADFGVGEIFPGGQESHQHSYCRHPXGYMAPEYLAHGQLTEKADVYSFGVLLLEDYHS

PatternScan: PS00107
IPR017441
52-74 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGGFGTVYKGILPDGREIAVK

Gene3D: G3DSA:1.10.510.10
108-240 no description

CSCSGPESLLVYEYLPNKSLDRFIFDATRGKTLNWEQRYQIIIGTAEGLVYLHENSNVRIIHRDIKASNILLDSKLRARIADFGVGEIFPGGQESHQHSYCRHPXGYMAPEYLAHGQLTEKADVYSFGVLLLE

PatternScan: PS00108
IPR008271
167-179 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKASNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox