PRGDB00079631 (Cpp.2658)

From PRG Wiki
Jump to: navigation, search
Cpp.2658
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 186796323 (EX274324)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis lyrata subsp. lyrata

Comment?

1455479_5_I05_023 PY06 Carica papaya cDNA, mRNA sequence

DNA Sequence

CGTGTTATCAAAttttttttttACGCAGACGGTATCGGCATTACGGCCGGGGTAGGATACTGTTTATGGACCGGGGTCTGTTTCGGGAAGAAGAAAGTGCACAACTCAGTTCAACCCACAATCGGCAGAGCAGGTTCCAATGGCGGCAATCCATCATCAAGTAATAGCCCACCATCCCGTTCCTCCACAATACGGCGGCAAGGCTCACGAGTCCTGGCAATGAGACGACAAAGGAGTGGAACCTCATCGACAAAACACGCAGATAAAGCAGAGGAGTTTTCCCTCGCCGAGCTCGCCGCTGCCACAAACAATTTCTCCAAAGAAAACAAGATCGGCGCCGGCAGCTTCGGGATTGTCTATAAAGGAAAACTACCAGACGGGCGTGAAGTAGCAATCAAGAGAGGCGAAACCGGATCAAAAACCAAGAAATTTCAAGAAAAAGAAACCGCGTTTGATTCAGAACTCGCTTTCTTATCCAGACTCCATCACAAACACCTGGTGCGCCTTGTTGGGTACTGCGAAGAACACGAAGAGCGGCTCCTGGTTTACGAGTACATGAAAAATGGCGCTTTATACGACCATTTACATGATAGAAACAATGTAGAGAAATCCAACAGCGTGTTGAATTCATGGAAAATAAGAATCAAAATTGCCTTAGACGCGGCCAGAGGCATTGAGTATCTCCACAATTATGCAGTTCCTCCGATAATCCACAGAGACATTAAGTCCTCCAACATTCTCCTCGATGTTACATGGACGGCAAGAGTCTCGGATTTCGGGTTATCGCTGATGGGTCCCGGAGTTTGATCGCGAATGCACGCCAATGAAAGGCGGCCGGGACAGTTGGGTACATTGATCCGGAGTACTACGGTCTTAATGTGTTGACAGCAAGAGTGATGTGTATGGGCTTGGCGTGGTGTTGCTGGAGCTTTTGACGGGGAAGAGAGCTATTTTTTAAGGTAGCGACGAGAGTGGAACTCCAGTGAGTGTGGTAGATTTTGCAGTGCCGCCGATCATGCCGGGGATTAGAAAAGATTTGATACGAGAGTCGAACGGCAAGATCAGTGAGCAGAAGCAGTGGAGCTGGTGGCTTATACTGCTATG


Protein sequences

Name Description Sequence
Cpp.2658 translated coding region predicted by ESTScan from UniGene Cpp.2658

RVIKFFFYADGIGITAGVGYCLWTGVCFGKKKVHNSVQPTIGRAGSNGGNPSSSNSPPSRSSTIRRQGSRVLAMRRQRSGTSSTKHADKAEEFSLAELAAATNNFSKENKIGAGSFGIVYKGKLPDGREVAIKRGETGSKTKKFQEKETAFDSELAFLSRLHHKHLVRLVGYCEEHEERLLVYEYMKNGALYDHLHDRNNVEKSNSVLNSWKIRIKIALDAARGIEYLHNYAVPPIIHRDIKSSNILLDVTWTARVSDFGLSLMGPGV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF875
18-266 SUBFAMILY NOT NAMED

VGYCLWTGVCFGKKKVHNSVQPTIGRAGSNGGNPSSSNSPPSRSSTIRRQGSRVLAMRRQRSGTSSTKHADKAEEFSLAELAAATNNFSKENKIGAGSFGIVYKGKLPDGREVAIKRGETGSKTKKFQEKETAFDSELAFLSRLHHKHLVRLVGYCEEHEERLLVYEYMKNGALYDHLHDRNNVEKSNSVLNSWKIRIKIALDAARGIEYLHNYAVPPIIHRDIKSSNILLDVTWTARVSDFGLSLMGP

HMMPanther: PTHR24420
18-266 FAMILY NOT NAMED,FAMILY NOT NAMED

VGYCLWTGVCFGKKKVHNSVQPTIGRAGSNGGNPSSSNSPPSRSSTIRRQGSRVLAMRRQRSGTSSTKHADKAEEFSLAELAAATNNFSKENKIGAGSFGIVYKGKLPDGREVAIKRGETGSKTKKFQEKETAFDSELAFLSRLHHKHLVRLVGYCEEHEERLLVYEYMKNGALYDHLHDRNNVEKSNSVLNSWKIRIKIALDAARGIEYLHNYAVPPIIHRDIKSSNILLDVTWTARVSDFGLSLMGP

Seg: seg
45-62 seg

GSNGGNPSSSNSPPSRSS

superfamily: SSF56112
IPR011009
77-264 Protein kinase-like (PK-like)
Protein kinase-like domain

QRSGTSSTKHADKAEEFSLAELAAATNNFSKENKIGAGSFGIVYKGKLPDGREVAIKRGETGSKTKKFQEKETAFDSELAFLSRLHHKHLVRLVGYCEEHEERLLVYEYMKNGALYDHLHDRNNVEKSNSVLNSWKIRIKIALDAARGIEYLHNYAVPPIIHRDIKSSNILLDVTWTARVSDFGLSLM

Gene3D: G3DSA:3.30.200.20
85-172 no description

KHADKAEEFSLAELAAATNNFSKENKIGAGSFGIVYKGKLPDGREVAIKRGETGSKTKKFQEKETAFDSELAFLSRLHHKHLVRLVGY

Seg: seg
90-101 seg

AEEFSLAELAAA

ProfileScan: PS50011
IPR000719
105-268 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSKENKIGAGSFGIVYKGKLPDGREVAIKRGETGSKTKKFQEKETAFDSELAFLSRLHHKHLVRLVGYCEEHEERLLVYEYMKNGALYDHLHDRNNVEKSNSVLNSWKIRIKIALDAARGIEYLHNYAVPPIIHRDIKSSNILLDVTWTARVSDFGLSLMGPGV

HMMSmart: SM00220
IPR002290
105-268 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSKENKIGAGSFGIVYKGKLPDGREVAIKRGETGSKTKKFQEKETAFDSELAFLSRLHHKHLVRLVGYCEEHEERLLVYEYMKNGALYDHLHDRNNVEKSNSVLNSWKIRIKIALDAARGIEYLHNYAVPPIIHRDIKSSNILLDVTWTARVSDFGLSLMGPGV

HMMSmart: SM00219
IPR020635
105-268 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSKENKIGAGSFGIVYKGKLPDGREVAIKRGETGSKTKKFQEKETAFDSELAFLSRLHHKHLVRLVGYCEEHEERLLVYEYMKNGALYDHLHDRNNVEKSNSVLNSWKIRIKIALDAARGIEYLHNYAVPPIIHRDIKSSNILLDVTWTARVSDFGLSLMGPGV

HMMPfam: PF00069
IPR017442
106-263 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

SKENKIGAGSFGIVYKGKLPDGREVAIKRGETGSKTKKFQEKETAFDSELAFLSRLHHKHLVRLVGYCEEHEERLLVYEYMKNGALYDHLHDRNNVEKSNSVLNSWKIRIKIALDAARGIEYLHNYAVPPIIHRDIKSSNILLDVTWTARVSDFGLSL

PatternScan: PS00107
IPR017441
111-133 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGAGSFGIVYKGKLPDGREVAIK

Gene3D: G3DSA:1.10.510.10
173-262 no description

CEEHEERLLVYEYMKNGALYDHLHDRNNVEKSNSVLNSWKIRIKIALDAARGIEYLHNYAVPPIIHRDIKSSNILLDVTWTARVSDFGLS

PatternScan: PS00108
IPR008271
236-248 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox