PRGDB00079641 (Cpp.3440)

From PRG Wiki
Jump to: navigation, search
Cpp.3440
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 186875627 (EX256544)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis lyrata subsp. lyrata

Comment?

1436564_5_E02_011 PY06 Carica papaya cDNA, mRNA sequence

DNA Sequence

CCTGGAAATTCCCCGGGGGAATTCGGCCTTACGGCCGGGGTATATTATTGGTTATGGTGCATCAAGCACGGTGTATAAATGCGTGCTTAAAAATTGCAAACCAGTTGCAATCAAGAGACTGTACTCGTATCCACAGTGCAAGAAAGAATTTGAGACAGAGCTTGAAACAGTTGGGAGCATCAAACATCGAAATCTTGTGAGCCTCCAAGGATATTCTCTTTCGCACTCTGGGAACCTGCTCTTCTATGATTATATGGAAAATGGAAGCCTATGGGACCACCTTCATGGACCTATGATAAAGAAAAAGCTCGACTGGGACACTCGTCTTAAGATAGCGCTTGGAGCAGCACAAGGGCTAGCATATCTGCACCATGATTGTAGTCCCCGTATCATTCACAGGGATGTCAAGTCATCTAACATTCTGCTAGATAAGGATTTTGAGGCTCATCTCACTGACTTTGGTATTGCCAAAAGCTTATGCGTCTCAAAATCTCATACCTCAACTTATTTAATGGGCACCATTGGTTATATAGACCCTGAGTATGCCCGCACTTCACGTCTCACTGAGAAGTCCGATGTCTATAGCTATGGAATTGTGCTCCTTGAGTTGCTTACTGGGCGGAAAGCAGTTGATAACGAGTCTAATCTCCATCATCTGATATTGTCCAAGACTGCCAACAACGCAGTGATGGAAACTGTTGATCCTGAGATTACAGCCACTTGTAAAGATCTTGGAGCAGTAAAGAAAGTTTTTCAGCTTGCCCTTCTTTGCGCCAAAAGACAGCCATCAGATCGGGCCAACTATGCACGAAGTAACACGAGTCCTTGGCAGCCTCACACCATCAACTTCACCTCCAAAGCTGCAGCCAATTACCTCGACTCAACGCGCATCAATCTTAACTGGTAATAGATGCCTTGCTATGTGGATGAGTATGCAAATCTAAAGACTCCACACCTGGTAAATGTTCCCTCCATGAGCACTTCAGAT


Protein sequences

Name Description Sequence
Cpp.3440 translated coding region predicted by ESTScan from UniGene Cpp.3440

XLEIPRGNSALRPGYIIGYGASSTVYKCVLKNCKPVAIKRLYSYPQCKKEFETELETVGSIKHRNLVSLQGYSLSHSGNLLFYDYMENGSLWDHLHGPMIKKKLDWDTRLKIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFGIAKSLCVSKSHTSTYLMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLHHLILSKTANNAVMETVDPEITATCKDLGAVKKVFQLALLCAKRQPSDRANYARSNTSPWQPHTINFTSKAAANYLDSTRINLNWXXMPCYVDEYANLKTPHLVNVPSMSTSD

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
11-278 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LRPGYIIGYGASSTVYKCVLKNCKPVAIKRLYSYPQCKKEFETELETVGSIKHRNLVSLQGYSLSHSGNLLFYDYMENGSLWDHLHGPMIKKKLDWDTRLKIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFGIAKSLCVSKSHTSTYLMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLHHLILSKTANNAVMETVDPEITATCKDLGAVKKVFQLALLCAKRQPSDRANYARSNTSPWQ

HMMSmart: SM00220
IPR002290
11-278 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LRPGYIIGYGASSTVYKCVLKNCKPVAIKRLYSYPQCKKEFETELETVGSIKHRNLVSLQGYSLSHSGNLLFYDYMENGSLWDHLHGPMIKKKLDWDTRLKIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFGIAKSLCVSKSHTSTYLMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLHHLILSKTANNAVMETVDPEITATCKDLGAVKKVFQLALLCAKRQPSDRANYARSNTSPWQ

HMMSmart: SM00219
IPR020635
11-282 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LRPGYIIGYGASSTVYKCVLKNCKPVAIKRLYSYPQCKKEFETELETVGSIKHRNLVSLQGYSLSHSGNLLFYDYMENGSLWDHLHGPMIKKKLDWDTRLKIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFGIAKSLCVSKSHTSTYLMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLHHLILSKTANNAVMETVDPEITATCKDLGAVKKVFQLALLCAKRQPSDRANYARSNTSPWQPHTI

HMMPanther: PTHR24420:SF825
15-266 SUBFAMILY NOT NAMED

YIIGYGASSTVYKCVLKNCKPVAIKRLYSYPQCKKEFETELETVGSIKHRNLVSLQGYSLSHSGNLLFYDYMENGSLWDHLHGPMIKKKLDWDTRLKIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFGIAKSLCVSKSHTSTYLMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLHHLILSKTANNAVMETVDPEITATCKDLGAVKKVFQLALLCAKRQPSDR

HMMPanther: PTHR24420
15-266 FAMILY NOT NAMED,FAMILY NOT NAMED

YIIGYGASSTVYKCVLKNCKPVAIKRLYSYPQCKKEFETELETVGSIKHRNLVSLQGYSLSHSGNLLFYDYMENGSLWDHLHGPMIKKKLDWDTRLKIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFGIAKSLCVSKSHTSTYLMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLHHLILSKTANNAVMETVDPEITATCKDLGAVKKVFQLALLCAKRQPSDR

HMMPfam: PF00069
IPR017442
16-277 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

IIGYGASSTVYKCVLKNCKPVAIKRLYSYPQCKKEFETELETVGSIKHRNLVSLQGYSLSHSGNLLFYDYMENGSLWDHLHGPMIKKKLDWDTRLKIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFGIAKSLCVSKSHTSTYLMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLHHLILSKTANNAVMETVDPEITATCKDLGAVKKVFQLALLCAKRQPSDRANYARSNTSPW

superfamily: SSF56112
IPR011009
16-277 Protein kinase-like (PK-like)
Protein kinase-like domain

IIGYGASSTVYKCVLKNCKPVAIKRLYSYPQCKKEFETELETVGSIKHRNLVSLQGYSLSHSGNLLFYDYMENGSLWDHLHGPMIKKKLDWDTRLKIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFGIAKSLCVSKSHTSTYLMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLHHLILSKTANNAVMETVDPEITATCKDLGAVKKVFQLALLCAKRQPSDRANYARSNTSPW

PatternScan: PS00107
IPR017441
17-39 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGYGASSTVYKCVLKNCKPVAIK

Gene3D: G3DSA:3.30.200.20
17-87 no description

IGYGASSTVYKCVLKNCKPVAIKRLYSYPQCKKEFETELETVGSIKHRNLVSLQGYSLSHSGNLLFYDYME

Gene3D: G3DSA:1.10.510.10
88-278 no description

NGSLWDHLHGPMIKKKLDWDTRLKIALGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDFEAHLTDFGIAKSLCVSKSHTSTYLMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTGRKAVDNESNLHHLILSKTANNAVMETVDPEITATCKDLGAVKKVFQLALLCAKRQPSDRANYARSNTSPWQ

PatternScan: PS00108
IPR008271
131-143 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox