PRGDB00079738 (Fpr.448)

From PRG Wiki
Jump to: navigation, search
Fpr.448
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 237582130 (GO856878)
Gene Class N
Domain Type NBS
Gene Species Capsella grandiflora

Comment?

CLS_CLiFpEfSpn_30a1_1_e09cLibkit5LD_C05 CLS_CLiFpEfSPn_plant Festuca pratensis cDNA clone 30e09 5', mRNA sequence

DNA Sequence

ACACTCAAATTGAGAGCATGGAAATTGGTAGAGACAGCAGAAAGGAGTTAAAACAGGTTGTTCTTGTCCTAGAAAGCATGGTTGCTGACATGAAGGAGTTTGCTATATTTCTGATGAGCTACACTCGCATGTACCGCCAACCTTACAGCTCGTATTTATTTATAGACAAGTGTATGTTTGGCCGCCAAATAGAGAGGGAACAAGCCATCAGCTTCTTGCTACAAGCTGAGCCTCTAGTGGGTGGAAATTTAGGTGTCCTACCAATAGTTGGTCCTCGACTTATTGGGAAGAGCACTCTTGTGGAACATGTTTGCGATGATGAGCGTGTGCGCAATCACTTCTCCTTGATCTTGCGCTACAGAGGAAACGACCTTACGCATGAAACCGCAGCAACTTTCAGAGATCATTGTGTGATCAAGCATCAGAATATTGCCTCCGGTAAAGAAAGGTCGTTGGTTGTCATTGAGCTCTTAGGGGACGTGGATGAAGGGGCCTGGAAGAGGTTGCTGCAGACTTCTGAAAGATGCATGGCACATGGGAGCAAAATCATAATCACTAGCCGTTCAGAGAACATGGTCAGTGTTGGAACAACACAGGCCATCATGCTAAGATGTTTGTCTAAAGAAGCTTATTGGTATTTCTTCAAGATGCTCGTGTTCGGTAGCACGGATCCGGAGGAGCACCCAAAGTTAACATCCATTGCCATGGAGCTAGCCCTCTTGATGGGCGGATCTTTCATAGGAGCATGTATTGTTGCCGCCGTACTGAGAGCAAATCTCAGTGCTAGGTTCTGGTCCAGTGTTTTCAGAGAGGTTAGGAAGTACACACAGAATAATACCTTGGTGTCCGGTGAATATCCCGAGGATCATATGACCCGGTACGTTTGGAGCATTCCTGAAGACTGCGAAGTTCCGAGGATCGTGGGCTGTTTCTGATACATCATAGTCACCAAAAAGGGTCCTGACACTCACGGCGAAGTTCCAAGGATACAGTGGTGGATCTTATATCTAGGGACCTGCAGCGCTTTGCCGAGGGGAAAATTTGA


Protein sequences

Name Description Sequence
Fpr.448 translated coding region predicted by ESTScan from UniGene Fpr.448

XTQIESMEIGRDSRKELKQVVLVLESMVADMKEFAIFLMSYTRMYRQPYSSYLFIDKCMFGRQIEREQAISFLLQAEPLVGGNLGVLPIVGPRLIGKSTLVEHVCDDERVRNHFSLILRYRGNDLTHETAATFRDHCVIKHQNIASGKERSLVVIELLGDVDEGAWKRLLQTSERCMAHGSKIIITSRSENMVSVGTTQAIMLRCLSKEAYWYFFKMLVFGSTDPEEHPKLTSIAMELALLMGGSFIGACIVAAVLRANLSARFWSSVFREVRKYTQNNTLVSGEYPEDHMTRYVWSIPEDCEVPRIVGCFXYIIVTKKGPDTHGEVPRIQWWILYLGTCSALPRGKFX

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
41-280 P-loop containing nucleoside triphosphate hydrolases

YTRMYRQPYSSYLFIDKCMFGRQIEREQAISFLLQAEPLVGGNLGVLPIVGPRLIGKSTLVEHVCDDERVRNHFSLILRYRGNDLTHETAATFRDHCVIKHQNIASGKERSLVVIELLGDVDEGAWKRLLQTSERCMAHGSKIIITSRSENMVSVGTTQAIMLRCLSKEAYWYFFKMLVFGSTDPEEHPKLTSIAMELALLMGGSFIGACIVAAVLRANLSARFWSSVFREVRKYTQNNT

HMMPfam: PF00931
IPR002182
148-278 NB-ARC,NBS
NB-ARC

KERSLVVIELLGDVDEGAWKRLLQTSERCMAHGSKIIITSRSENMVSVGTTQAIMLRCLSKEAYWYFFKMLVFGSTDPEEHPKLTSIAMELALLMGGSFIGACIVAAVLRANLSARFWSSVFREVRKYTQN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox