PRGDB00079742 (Fpr.754)

From PRG Wiki
Jump to: navigation, search
Fpr.754
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 237610424 (GO885260)
Gene Class Unknown
Domain Type
Gene Species Capsella grandiflora

Comment?

CLS_CLiFpEfSpn_95a4_1_j10cLibkit5LD_E05 CLS_CLiFpEfSPn_plant Festuca pratensis cDNA clone 95j10 5', mRNA sequence

DNA Sequence

ACGTTCAGATCTAATCTTTCTACAACCCAACCCAGTGGATTGTCTAATAATTCGTCTGCTCCCATACAGAAAAGGGCGCCAGCCAGTTCATCCGCTGCCCCTTCCTAGTAATCCCCACCAACAAAGAAGATATATACTATAGTTCTTGCTCAGCTCCAGCCACCCCAAATCTCTCCTTGTCGGCCACTCCCTCCCCAGGTCGGCTCATTCTTCTCCTTAGCTCGGAAGCGCTGCTAGGTTACTTGGATCGGCGACGCGTCAATTCCGTGCCCTTCTTGGAGTCTTGGATCCAAGAACCAGCCGGGACTTCTTGGATTTGGATCTCCCGCCTCTGCCTGCAATGGCGGCGCTCGTGGAGCTCTTCACGGGATCCTTTTCGTCCTCGGCGTCGGTGGACTGGGAGGCGGAGTCCTATCCGGCGTACGGCGACTACATCGTGCTCCCCATCCTCGTCGCCTTCTTCCCCGCCTTGCGCTTCCTCCTTGACCGATTCGTCTTCGAGGGATTAGCAAGGAGACTTATATTTGGGAAGGGATATGACAAGCTTGCCGAAACAGAAGACAGGAGAAAGAGAATCGATAAATTCAAGGAGTCCGCATGGAAATTTGTTTATTTTCTTTCTGCAGAAGTGCTTTCATTATCTGTAACATACAATGAGCCATGGTTTACAAATACCAGATACTTCTGGGTAGGGCCTGGCGAGCAGCTCTGGCCAGATCAAAAGATGAAGCTGAAGCTTAAGGCTGTATACATGTATGCTGCCGGATTTTACACATATTCCATCTTCGCTCTTCTGTTCTGGGAAACAAGACGCAAGGACTTCGGAGTCTCGATGTCTCACCATTTGGCAACAGTTGTTCTGGTTGTTATGTCATATATTTGCAGATTGTCTCGTGCTGGCTCGGTCATTTTAGCTGTCCATGATGCAAGTGATATATTCCTAGAGATCGGAAAGATGGCCAAGTATAGTAGCTGTGAGGGGCTAGCTGTTGTGCATTTCTGCTTTTGTGGCTTCGTGGATCCTACTTCGGCTAATTATATCCCTTTCTGGATCTAGAGCACAAGCTATGA


Protein sequences

Name Description Sequence
Fpr.754 translated coding region predicted by ESTScan from UniGene Fpr.754

MAALVELFTGSFSSSASVDWEAESYPAYGDYIVLPILVAFFPALRFLLDRFVFEGLARRLIFGKGYDKLAETEDRRKRIDKFKESAWKFVYFLSAEVLSLSVTYNEPWFTNTRYFWVGPGEQLWPDQKMKLKLKAVYMYAAGFYTYSIFALLFWETRRKDFGVSMSHHLATVVLVVMSYICRLSRAGSVILAVHDASDIFLEIGKMAKYSSCEGLAVVHFCFCGFVDPTSANYIPFWIXSTSYX


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR12560
19-226 FAMILY NOT NAMED,LONGEVITY ASSURANCE FACTOR 1 (LAG1)

DWEAESYPAYGDYIVLPILVAFFPALRFLLDRFVFEGLARRLIFGKGYDKLAETEDRRKRIDKFKESAWKFVYFLSAEVLSLSVTYNEPWFTNTRYFWVGPGEQLWPDQKMKLKLKAVYMYAAGFYTYSIFALLFWETRRKDFGVSMSHHLATVVLVVMSYICRLSRAGSVILAVHDASDIFLEIGKMAKYSSCEGLAVVHFCFCGFV

ProfileScan: PS50922
IPR006634
80-244 TLC
TRAM/LAG1/CLN8 homology domain

DKFKESAWKFVYFLSAEVLSLSVTYNEPWFTNTRYFWVGPGEQLWPDQKMKLKLKAVYMYAAGFYTYSIFALLFWETRRKDFGVSMSHHLATVVLVVMSYICRLSRAGSVILAVHDASDIFLEIGKMAKYSSCEGLAVVHFCFCGFVDPTSANYIPFWIXSTSYX

HMMSmart: SM00724
IPR006634
80-240 TRAM, LAG1 and CLN8 homology domains.
TRAM/LAG1/CLN8 homology domain

DKFKESAWKFVYFLSAEVLSLSVTYNEPWFTNTRYFWVGPGEQLWPDQKMKLKLKAVYMYAAGFYTYSIFALLFWETRRKDFGVSMSHHLATVVLVVMSYICRLSRAGSVILAVHDASDIFLEIGKMAKYSSCEGLAVVHFCFCGFVDPTSANYIPFWIXS

HMMPfam: PF03798
IPR006634
81-220 TRAM_LAG1_CLN8
TRAM/LAG1/CLN8 homology domain

KFKESAWKFVYFLSAEVLSLSVTYNEPWFTNTRYFWVGPGEQLWPDQKMKLKLKAVYMYAAGFYTYSIFALLFWETRRKDFGVSMSHHLATVVLVVMSYICRLSRAGSVILAVHDASDIFLEIGKMAKYSSCEGLAVVHF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox