PRGDB00079751 (Fpr.1275)

From PRG Wiki
Jump to: navigation, search
Fpr.1275
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 237593359 (GO871429)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Capsella grandiflora

Comment?

CLS_CLiFpEfSpn_61a1_2_e19cLibkit5LD_C10 CLS_CLiFpEfSPn_plant Festuca pratensis cDNA clone 61e19 5', mRNA sequence

DNA Sequence

ATCGGAAGGGAGGGATGCTGAGGTGTAAGAGGAAGCTTGCTGATGGACAGTTTGTGGCAGTGAAGAGACTAAAAAAGGTGGTAAAAAGAGGAAGGATTAGCGACTCTATTGAGCTTGGAATTATAGAATGTTAACACCAAATGCGGAAGCTCTGGGGTTAGTGTGGAAGGTGGCTTGACTTGGTTCTTAATTCTACACTGGAAGCTTGGCTTCTGTTCTCATGGTGCAAAGGGAGCCCTCAGGTGGAAGGCCCGGTTAGTATTGCACTTGGAATCGCTGAAGGGCTATTTTATCTACATGAAGGTTGTCATCGGCACATCATTCACAGAGACATCAAGGCTTCAATATTCTTTTAACTGAAGAGTATCAACCTCAGATTTCAGACTTTGGCCTTGCGAAATGGCTTCCTGATAAATGCACCCATCAGGTTGTGTTCCCCATTGAAGGCACATTTGGGTATATGGCTCCGAGTACTTCATGCATGGGATCATAAATGAGAAGACCGACGTATTTGCATATGGAGTATTGCTTCTTGAACTAGTGACTGGGCGGAAAGCGGTGGACTCTTCAGACAAAGCCTAGTGATATGGGCAAAACCGCTGCTCGAATCGAACAACATGAAAGGACTAGTGGATCCTTCTCTTGATGCTGGATATGACCCAGAAGAGATGGCACTCACCCTAGCAGTGGCATCGATGTGCATTCACCACAGCTCAACTTGCGGCCTAGCATGAGATCGGTGGTCCGTTTCTTGAAGGGAGACAGAGAATCACTTGAACTGATGGGGAAGCCTGAAACCACGAAGCCCCCTATGTTTGACTCCTGTGATTCGAAGATTACACTCGCACGGTTACCTCATGATCTGGACAGCACAACAGCTGCCTTGGAGCGTAATCTAGTTGGGCTTGGACGATTTTGTCTTTTTGTACTTGTACGCTACTTGCGATCTCCTGCTTTCAGAGATGCTCAAGATGTATGGATAGAGTGAGGATAAATACTTCCTGGTGATGATTTAGTGTCGGTTGGCTGCAAAAAGAAAAAATAAGAAAAAAAAAAAAAAAAAAA


Protein sequences

Name Description Sequence
Fpr.1275 translated coding region predicted by ESTScan from UniGene Fpr.1275

XRKGGMLRCKRKLADGQFVAVKRLKKVVKRGRISDSIELGIKNVNTKCGSSGVSVEGGLTWFLILHWKLGFCSHGAKGALRWKARLVLHLESLKGYFIYMKVVIGTSFTENQGFNILLTEEYQPQISDFGLAKWLPDKCTHQVVFPIEGTFGYMAPEYFMHGIINEKTDVFAYGVLLLELVTXAESGGLFRQSLVIWAKPLLESNNMKGLVDPSLDAGYDPEEMALTLAVAIDVHSPQLNLRPSMRSVVRFLKGDRESLELMGKPETTKPPMFDSCDSKITLARLPHDLDSTTAALERNLVGLGRFCLFVLVRYLRSPAFRDAQDVWIE

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-259 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XRKGGMLRCKRKLADGQFVAVKRLKKVVKRGRISDSIELGIKNVNTKCGSSGVSVEGGLTWFLILHWKLGFCSHGAKGALRWKARLVLHLESLKGYFIYMKVVIGTSFTENQGFNILLTEEYQPQISDFGLAKWLPDKCTHQVVFPIEGTFGYMAPEYFMHGIINEKTDVFAYGVLLLELVTXAESGGLFRQSLVIWAKPLLESNNMKGLVDPSLDAGYDPEEMALTLAVAIDVHSPQLNLRPSMRSVVRFLKGDRESL

HMMSmart: SM00220
IPR002290
7-301 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LRCKRKLADGQFVAVKRLKKVVKRGRISDSIELGIKNVNTKCGSSGVSVEGGLTWFLILHWKLGFCSHGAKGALRWKARLVLHLESLKGYFIYMKVVIGTSFTENQGFNILLTEEYQPQISDFGLAKWLPDKCTHQVVFPIEGTFGYMAPEYFMHGIINEKTDVFAYGVLLLELVTXAESGGLFRQSLVIWAKPLLESNNMKGLVDPSLDAGYDPEEMALTLAVAIDVHSPQLNLRPSMRSVVRFLKGDRESLELMGKPETTKPPMFDSCDSKITLARLPHDLDSTTAALERNLV

HMMSmart: SM00219
IPR020635
7-252 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LRCKRKLADGQFVAVKRLKKVVKRGRISDSIELGIKNVNTKCGSSGVSVEGGLTWFLILHWKLGFCSHGAKGALRWKARLVLHLESLKGYFIYMKVVIGTSFTENQGFNILLTEEYQPQISDFGLAKWLPDKCTHQVVFPIEGTFGYMAPEYFMHGIINEKTDVFAYGVLLLELVTXAESGGLFRQSLVIWAKPLLESNNMKGLVDPSLDAGYDPEEMALTLAVAIDVHSPQLNLRPSMRSVVRFL

Seg: seg
19-32 seg

VAVKRLKKVVKRGR

superfamily: SSF56112
IPR011009
115-298 Protein kinase-like (PK-like)
Protein kinase-like domain

NILLTEEYQPQISDFGLAKWLPDKCTHQVVFPIEGTFGYMAPEYFMHGIINEKTDVFAYGVLLLELVTXAESGGLFRQSLVIWAKPLLESNNMKGLVDPSLDAGYDPEEMALTLAVAIDVHSPQLNLRPSMRSVVRFLKGDRESLELMGKPETTKPPMFDSCDSKITLARLPHDLDSTTAALER

HMMPanther: PTHR24420:SF794
115-324 SUBFAMILY NOT NAMED

NILLTEEYQPQISDFGLAKWLPDKCTHQVVFPIEGTFGYMAPEYFMHGIINEKTDVFAYGVLLLELVTXAESGGLFRQSLVIWAKPLLESNNMKGLVDPSLDAGYDPEEMALTLAVAIDVHSPQLNLRPSMRSVVRFLKGDRESLELMGKPETTKPPMFDSCDSKITLARLPHDLDSTTAALERNLVGLGRFCLFVLVRYLRSPAFRDAQ

HMMPanther: PTHR24420
115-324 FAMILY NOT NAMED,FAMILY NOT NAMED

NILLTEEYQPQISDFGLAKWLPDKCTHQVVFPIEGTFGYMAPEYFMHGIINEKTDVFAYGVLLLELVTXAESGGLFRQSLVIWAKPLLESNNMKGLVDPSLDAGYDPEEMALTLAVAIDVHSPQLNLRPSMRSVVRFLKGDRESLELMGKPETTKPPMFDSCDSKITLARLPHDLDSTTAALERNLVGLGRFCLFVLVRYLRSPAFRDAQ

HMMPfam: PF00069
IPR017442
115-183 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

NILLTEEYQPQISDFGLAKWLPDKCTHQVVFPIEGTFGYMAPEYFMHGIINEKTDVFAYGVLLLELVTX

Gene3D: G3DSA:1.10.510.10
115-270 no description

NILLTEEYQPQISDFGLAKWLPDKCTHQVVFPIEGTFGYMAPEYFMHGIINEKTDVFAYGVLLLELVTXAESGGLFRQSLVIWAKPLLESNNMKGLVDPSLDAGYDPEEMALTLAVAIDVHSPQLNLRPSMRSVVRFLKGDRESLELMGKPETTKP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox