PRGDB00079855 (Les.90)

From PRG Wiki
Jump to: navigation, search
Les.90
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 3201540 (AJ005077)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Solanum lycopersicum

Comment?

Lycopersicon esculentum mRNA for protein kinase TCTR2

DNA Sequence

AATATgagagagagagagTGTATGAAGACTAACAGTAGTAGCAGTTGATTAGTATATACTGAAAGGAAAAAGTAAGGGTATGATATAGAGAGAGAAACAATGAAACACATTTTCAAGAAGCTTCATCATTCAAATCGATCGAACGATGCTCAATCTACTTCATCAATATCATCGTCATCTTCACCTGCATCATCGTTGTCTTCGGCGTCATGTACTACTGATCATCGGAATTCCAATTCGGTTTCTCAATCACCGTTGAGTCCTTCCACGATTTCAACTGCGTCAACGACGACCACTCCTGCTGCTCCAGTGGGGGCTGGTGGTGGTGGTGGAGGAGGGAATTTATCTACGATCAACAGACAGCAGGACTATTATACTTCGGAGGAAGAGTATCAAGTGCAACTTGCCCTAGCTTTGAGTGTGTCATCCTCCCAGTCTCAAGATCCTTTTCCCTCTGATGTTAATTCAAGCAATGGTCATGGTGTAGGGCGAACCGCTGTTGACTTGGCACGTGATAGAGAGGATGCCGCTGCGGACTTGCTATCGAGGCAGTATTGGGATTATGGTGTGATGGATTATGAGGAGAAAGTTGTTGATGGCTTCTATGATGTATATAATCTCTTTACAGATCCAGCAAGTCGTGGGAAAATGCCATCTCTTTCTGAACTTGAAACAAATCCTGGGACTTCTAACTTTGAAGGCGTGATAATTAATCAGAGAATTGACCCCTCCTTGGAAGAGTTGATGCAGATTGCACACTGTATTACATTGGACTGCCCTGCCAGTGAGATTAGTCTGTTAGTACTGAGGCTTTCTGAACTTGTAACTGGGCATTTAGGTGGCCCAGTAAAGGATGCAAATATCATATTGGCCAAATGGATGGAAATTAGCACTGAGTTGAGGACATCACTTCACACCAGTGTGTTGCCAATCGGATCCCTAAAAATTGGGCTTTCACGTCACCGTGCACTGCTTTTTAAGGTACTAGCTGACCATGTTGGAATACCCTGTAGACTTGTTAAAGGGAGTCACTACACTGGTGTTGAAGATGATGCTGTCAACATTGTGAAGTTACCGAATGATAGCGAGTTTTTGGTTGATCTCATGGGAGCACCAGGCACACTCATACCGGCTGATGTTCTGAGTGCAAAGGATGCTTCTTTTAACAGTCCGAAATTGAACAAGATTCCAAGTTTGCCGTCCAATAGTCATTCTGGAGTTTCCTACCCGAGACGGAACTTGTTATCTGGTCAAAATTCTGTGTTAGGAGATGATTTCTCCGGTAGATCTAAGCCCGAGAAGATAGAATCAGTTCATTCAATCTCTGATGCAGGTGGTAGCTCCACTGCTGGTTCTTCAGGAATCAACAAAAGACCATCTTCTAATCAGGTTGATTGGACTTCACCGTTAGCAATTGGAACTTCTTTGTACAAAGGAGGCCGTGGACCCAATGCCGCTGGTGATGGCTTGAGGTTGAATGTAAATGTTGTTCCTTATGATCAGAATAACCCTGAGGATCCAAAAAATCTTTTTGCTGATCTTAATCCGTTTCAAATAAAAGGCTCTGGCAACACATTACTGCAGAAAAATCCTGCTAGAAACAAAGTCAGTGAGTTGCAACAGCCAATAAATACTTTGATCCCCGGACGGCCTCCTGCCCCTATGATGTGGAAAAATCGATATGCACCCAATGAGGTGCCCCGGAAAAACGAATCTGATTCTGAGGGACTTTTTCCAAAGAAGAACGGTGGATCTAGTGGGTATAATATATCATCAATCGCATCTACCAGCTCAAATATACCGCAGAAGTCTTCTACTGATACCTCCAGGTTACATGGAAATTCACGGCCTGCCTATAGAGGAAATGATGAGGTTGCTTCCACTAGGAATAACAGTTCCATATTATCAGCTGAGCTTGAATTTAGAAGGTTGTCTGTTCagaacagtcaaaacaataatagagaaacaagtcaatgggaGGGGCACAGTTTGCAGAGTGACGACTTAAATAGGACACAAGCATATGGAGATGATATTATTGTGGAAAGTGATCACACAAGAAATTTGCAAGCTCAGTCAATAGGAACCAATATTAAATTGAAGGAGCCAGAAAATCCAACTTCTTCAGGGAATCTAGGTCCAAGTCAGGTTGATCCTGTGTTTGATGATGTTGGTGATTGTGAGATTCCATGGGAAGATCTTGTCATTGGCGAGAGGATTGGTCTTGGTTCCTATGGAGAGGTTTACCATGCAGATTGGAATGGCACTGAGGTTGCTGTAAAGAAGTTCCTCGATCAGGATTTCTCAGGTGCAGCGTTGGCTGAGTTTAAGAGAGAGGTGCGCATCATGCGTCGATTACGACATCCAAATGTTGTTCGTTTTATGGGTGCTATAACTCGGCCGCCCCACCTTTCTATTATCACTGAATTCCTACCACGAGGTAGCTTATATCGGATAATTCATCGTCCTCATTTTCAAATTGATGAAAGGCAAAAAATCAAAATGGCCCTTGATGTGGCAAAGGGCATGGATTGCTTACATACAAGCAACCCTACAATTGTTCACCGCGATCTGAAGTCACCTAATCTTTTGGTTGATACGGACTGGAATGTTAAGGTATGTGATTTTGGCTTGTCTCGGTTGAAGCACAACACATTTTTGTCTTCCAAATCAACAGCTGGAACGCCTGAGTGGATGGCACCAGAAGTTCTCCGCAATGAACCTTCGAATGAGAAGTGTGACATATACAGTTTTGGTGTCATTCTATGGGAACTTGCTACCTTAAGATTACCTTGGAGTGGAATGAATCCTATGCAAGTGGTGGGAGCTGTTGGCTTCCAAAATAAACGCCTTGAAATTCCCAAGGAACTTGATCCTATAGTAGCAAGAATAATATGGGAATGTTGGCAAACCGATCCAAACTTGCGTCCATCATTTGCACAGCTAACTGTGGCTTTAACACCATTGCAACGACTTGTCATTCCTGCCTATGTAGATCAGCTGAACTCCCGCTTGCCTCAGGAAATCTCAGTAAATTCTACCCCGTAAATTTCCTCGTCTTCCTCAAGTGCTGATCACTTGGGAAAAAGAAGGTTTCTGGTTTCGCTCATTTGCAAAAATGGAAAGATTCTTGGCGAAGTGGGTAAATGGTTCTTGTTGCTCAGAGATGATTTAGGAAGAAAAAGCAAAAGCAACCTTGGTAGTGGTCCTTAAATGTGTTGTTACTTGTATAGTGGTTGTGTATAAGTTGATCCCAAAGGGAACGGGTGTCTTTCTGAGTTGTATAGTCTTAATGATCATAAATTCGTTGGTTGAAAAACCCCCCTTCGAAATAATGGGGTGGTGCCGCACATAATCCCTGTATAGTCTATACAACAGAAGCTAAGTTGTCTCTTATAATGAATATATATGGTTGCCTTCAAAAACAGTACTACAATATCTCACGTATATTATGCC


Protein sequences

Name Description Sequence
Les.90 translated coding region predicted by ESTScan from UniGene Les.90

MKHIFKKLHHSNRSNDAQSTSSISSSSSPASSLSSASCTTDHRNSNSVSQSPLSPSTISTASTTTTPAAPVGAGGGGGGGNLSTINRQQDYYTSEEEYQVQLALALSVSSSQSQDPFPSDVNSSNGHGVGRTAVDLARDREDAAADLLSRQYWDYGVMDYEEKVVDGFYDVYNLFTDPASRGKMPSLSELETNPGTSNFEGVIINQRIDPSLEELMQIAHCITLDCPASEISLLVLRLSELVTGHLGGPVKDANIILAKWMEISTELRTSLHTSVLPIGSLKIGLSRHRALLFKVLADHVGIPCRLVKGSHYTGVEDDAVNIVKLPNDSEFLVDLMGAPGTLIPADVLSAKDASFNSPKLNKIPSLPSNSHSGVSYPRRNLLSGQNSVLGDDFSGRSKPEKIESVHSISDAGGSSTAGSSGINKRPSSNQVDWTSPLAIGTSLYKGGRGPNAAGDGLRLNVNVVPYDQNNPEDPKNLFADLNPFQIKGSGNTLLQKNPARNKVSELQQPINTLIPGRPPAPMMWKNRYAPNEVPRKNESDSEGLFPKKNGGSSGYNISSIASTSSNIPQKSSTDTSRLHGNSRPAYRGNDEVASTRNNSSILSAELEFRRLSVQNSQNNNRETSQWEGHSLQSDDLNRTQAYGDDIIVESDHTRNLQAQSIGTNIKLKEPENPTSSGNLGPSQVDPVFDDVGDCEIPWEDLVIGERIGLGSYGEVYHADWNGTEVAVKKFLDQDFSGAALAEFKREVRIMRRLRHPNVVRFMGAITRPPHLSIITEFLPRGSLYRIIHRPHFQIDERQKIKMALDVAKGMDCLHTSNPTIVHRDLKSPNLLVDTDWNVKVCDFGLSRLKHNTFLSSKSTAGTPEWMAPEVLRNEPSNEKCDIYSFGVILWELATLRLPWSGMNPMQVVGAVGFQNKRLEIPKELDPIVARIIWECWQTDPNLRPSFAQLTVALTPLQRLVIPAYVDQLNSRLPQEISVNSTPXISSSSSSADHLGKRRFLVSLICKNGKILGEVGKWFLLLRDDLGRKSKSNLGSGP

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23257:SF80
10-958 MAP3K DELTA-1 PROTEIN KINASE,MAP3K DELTA-1 PROTEIN KINASE

HSNRSNDAQSTSSISSSSSPASSLSSASCTTDHRNSNSVSQSPLSPSTISTASTTTTPAAPVGAGGGGGGGNLSTINRQQDYYTSEEEYQVQLALALSVSSSQSQDPFPSDVNSSNGHGVGRTAVDLARDREDAAADLLSRQYWDYGVMDYEEKVVDGFYDVYNLFTDPASRGKMPSLSELETNPGTSNFEGVIINQRIDPSLEELMQIAHCITLDCPASEISLLVLRLSELVTGHLGGPVKDANIILAKWMEISTELRTSLHTSVLPIGSLKIGLSRHRALLFKVLADHVGIPCRLVKGSHYTGVEDDAVNIVKLPNDSEFLVDLMGAPGTLIPADVLSAKDASFNSPKLNKIPSLPSNSHSGVSYPRRNLLSGQNSVLGDDFSGRSKPEKIESVHSISDAGGSSTAGSSGINKRPSSNQVDWTSPLAIGTSLYKGGRGPNAAGDGLRLNVNVVPYDQNNPEDPKNLFADLNPFQIKGSGNTLLQKNPARNKVSELQQPINTLIPGRPPAPMMWKNRYAPNEVPRKNESDSEGLFPKKNGGSSGYNISSIASTSSNIPQKSSTDTSRLHGNSRPAYRGNDEVASTRNNSSILSAELEFRRLSVQNSQNNNRETSQWEGHSLQSDDLNRTQAYGDDIIVESDHTRNLQAQSIGTNIKLKEPENPTSSGNLGPSQVDPVFDDVGDCEIPWEDLVIGERIGLGSYGEVYHADWNGTEVAVKKFLDQDFSGAALAEFKREVRIMRRLRHPNVVRFMGAITRPPHLSIITEFLPRGSLYRIIHRPHFQIDERQKIKMALDVAKGMDCLHTSNPTIVHRDLKSPNLLVDTDWNVKVCDFGLSRLKHNTFLSSKSTAGTPEWMAPEVLRNEPSNEKCDIYSFGVILWELATLRLPWSGMNPMQVVGAVGFQNKRLEIPKELDPIVARIIWECWQTDPNLRPSFAQLTVALTPLQR

HMMPanther: PTHR23257
10-958 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

HSNRSNDAQSTSSISSSSSPASSLSSASCTTDHRNSNSVSQSPLSPSTISTASTTTTPAAPVGAGGGGGGGNLSTINRQQDYYTSEEEYQVQLALALSVSSSQSQDPFPSDVNSSNGHGVGRTAVDLARDREDAAADLLSRQYWDYGVMDYEEKVVDGFYDVYNLFTDPASRGKMPSLSELETNPGTSNFEGVIINQRIDPSLEELMQIAHCITLDCPASEISLLVLRLSELVTGHLGGPVKDANIILAKWMEISTELRTSLHTSVLPIGSLKIGLSRHRALLFKVLADHVGIPCRLVKGSHYTGVEDDAVNIVKLPNDSEFLVDLMGAPGTLIPADVLSAKDASFNSPKLNKIPSLPSNSHSGVSYPRRNLLSGQNSVLGDDFSGRSKPEKIESVHSISDAGGSSTAGSSGINKRPSSNQVDWTSPLAIGTSLYKGGRGPNAAGDGLRLNVNVVPYDQNNPEDPKNLFADLNPFQIKGSGNTLLQKNPARNKVSELQQPINTLIPGRPPAPMMWKNRYAPNEVPRKNESDSEGLFPKKNGGSSGYNISSIASTSSNIPQKSSTDTSRLHGNSRPAYRGNDEVASTRNNSSILSAELEFRRLSVQNSQNNNRETSQWEGHSLQSDDLNRTQAYGDDIIVESDHTRNLQAQSIGTNIKLKEPENPTSSGNLGPSQVDPVFDDVGDCEIPWEDLVIGERIGLGSYGEVYHADWNGTEVAVKKFLDQDFSGAALAEFKREVRIMRRLRHPNVVRFMGAITRPPHLSIITEFLPRGSLYRIIHRPHFQIDERQKIKMALDVAKGMDCLHTSNPTIVHRDLKSPNLLVDTDWNVKVCDFGLSRLKHNTFLSSKSTAGTPEWMAPEVLRNEPSNEKCDIYSFGVILWELATLRLPWSGMNPMQVVGAVGFQNKRLEIPKELDPIVARIIWECWQTDPNLRPSFAQLTVALTPLQR

Seg: seg
14-37 seg

SNDAQSTSSISSSSSPASSLSSAS

Seg: seg
44-86 seg

NSNSVSQSPLSPSTISTASTTTTPAAPVGAGGGGGGGNLSTIN

Seg: seg
99-114 seg

QVQLALALSVSSSQSQ

Seg: seg
135-150 seg

DLARDREDAAADLLSR

HMMPfam: PF14381
144-344 EDR1,Ethylene-responsive protein kinase Le-CTR1

AADLLSRQYWDYGVMDYEEKVVDGFYDVYNLFTDPASRGKMPSLSELETNPGTSNFEGVIINQRIDPSLEELMQIAHCITLDCPASEISLLVLRLSELVTGHLGGPVKDANIILAKWMEISTELRTSLHTSVLPIGSLKIGLSRHRALLFKVLADHVGIPCRLVKGSHYTGVEDDAVNIVKLPNDSEFLVDLMGAPGTLIP

Seg: seg
407-422 seg

SISDAGGSSTAGSSGI

Seg: seg
549-567 seg

NGGSSGYNISSIASTSSNI

superfamily: SSF56112
IPR011009
673-974 Protein kinase-like (PK-like)
Protein kinase-like domain

PTSSGNLGPSQVDPVFDDVGDCEIPWEDLVIGERIGLGSYGEVYHADWNGTEVAVKKFLDQDFSGAALAEFKREVRIMRRLRHPNVVRFMGAITRPPHLSIITEFLPRGSLYRIIHRPHFQIDERQKIKMALDVAKGMDCLHTSNPTIVHRDLKSPNLLVDTDWNVKVCDFGLSRLKHNTFLSSKSTAGTPEWMAPEVLRNEPSNEKCDIYSFGVILWELATLRLPWSGMNPMQVVGAVGFQNKRLEIPKELDPIVARIIWECWQTDPNLRPSFAQLTVALTPLQRLVIPAYVDQLNSRLPQ

Gene3D: G3DSA:3.30.200.20
693-763 no description

DCEIPWEDLVIGERIGLGSYGEVYHADWNGTEVAVKKFLDQDFSGAALAEFKREVRIMRRLRHPNVVRFMG

ProfileScan: PS50011
IPR000719
701-957 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LVIGERIGLGSYGEVYHADWNGTEVAVKKFLDQDFSGAALAEFKREVRIMRRLRHPNVVRFMGAITRPPHLSIITEFLPRGSLYRIIHRPHFQIDERQKIKMALDVAKGMDCLHTSNPTIVHRDLKSPNLLVDTDWNVKVCDFGLSRLKHNTFLSSKSTAGTPEWMAPEVLRNEPSNEKCDIYSFGVILWELATLRLPWSGMNPMQVVGAVGFQNKRLEIPKELDPIVARIIWECWQTDPNLRPSFAQLTVALTPLQ

HMMSmart: SM00220
IPR002290
701-956 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LVIGERIGLGSYGEVYHADWNGTEVAVKKFLDQDFSGAALAEFKREVRIMRRLRHPNVVRFMGAITRPPHLSIITEFLPRGSLYRIIHRPHFQIDERQKIKMALDVAKGMDCLHTSNPTIVHRDLKSPNLLVDTDWNVKVCDFGLSRLKHNTFLSSKSTAGTPEWMAPEVLRNEPSNEKCDIYSFGVILWELATLRLPWSGMNPMQVVGAVGFQNKRLEIPKELDPIVARIIWECWQTDPNLRPSFAQLTVALTPL

HMMSmart: SM00219
IPR020635
701-953 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LVIGERIGLGSYGEVYHADWNGTEVAVKKFLDQDFSGAALAEFKREVRIMRRLRHPNVVRFMGAITRPPHLSIITEFLPRGSLYRIIHRPHFQIDERQKIKMALDVAKGMDCLHTSNPTIVHRDLKSPNLLVDTDWNVKVCDFGLSRLKHNTFLSSKSTAGTPEWMAPEVLRNEPSNEKCDIYSFGVILWELATLRLPWSGMNPMQVVGAVGFQNKRLEIPKELDPIVARIIWECWQTDPNLRPSFAQLTVAL

HMMPfam: PF07714
IPR001245
702-951 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

VIGERIGLGSYGEVYHADWNGTEVAVKKFLDQDFSGAALAEFKREVRIMRRLRHPNVVRFMGAITRPPHLSIITEFLPRGSLYRIIHRPHFQIDERQKIKMALDVAKGMDCLHTSNPTIVHRDLKSPNLLVDTDWNVKVCDFGLSRLKHNTFLSSKSTAGTPEWMAPEVLRNEPSNEKCDIYSFGVILWELATLRLPWSGMNPMQVVGAVGFQNKRLEIPKELDPIVARIIWECWQTDPNLRPSFAQLTV

PatternScan: PS00107
IPR017441
707-729 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGLGSYGEVYHADWNGTEVAVKK

Gene3D: G3DSA:1.10.510.10
764-949 no description

AITRPPHLSIITEFLPRGSLYRIIHRPHFQIDERQKIKMALDVAKGMDCLHTSNPTIVHRDLKSPNLLVDTDWNVKVCDFGLSRLKHNTFLSSKSTAGTPEWMAPEVLRNEPSNEKCDIYSFGVILWELATLRLPWSGMNPMQVVGAVGFQNKRLEIPKELDPIVARIIWECWQTDPNLRPSFAQL

FPrintScan: PR00109
IPR001245
775-788 TYRKINASE
Serine-threonine/tyrosine-protein kinase

TEFLPRGSLYRIIH

FPrintScan: PR00109
IPR001245
814-832 TYRKINASE
Serine-threonine/tyrosine-protein kinase

HTSNPTIVHRDLKSPNLLV

PatternScan: PS00108
IPR008271
820-832 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDLKSPNLLV

FPrintScan: PR00109
IPR001245
861-871 TYRKINASE
Serine-threonine/tyrosine-protein kinase

GTPEWMAPEVL

FPrintScan: PR00109
IPR001245
880-902 TYRKINASE
Serine-threonine/tyrosine-protein kinase

CDIYSFGVILWELATLRLPWSGM

FPrintScan: PR00109
IPR001245
924-946 TYRKINASE
Serine-threonine/tyrosine-protein kinase

LDPIVARIIWECWQTDPNLRPSF

Seg: seg
977-990 seg

SVNSTPXISSSSSS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox