PRGDB00079934 (Les.5672)

From PRG Wiki
Jump to: navigation, search
Les.5672
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 47105778 (BT014363)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Solanum lycopersicum

Comment?

Lycopersicon esculentum clone 133649F, mRNA sequence

DNA Sequence

GAGTTATAACAAGGTTCAAAAACTCTTTACTTTCATCTAGTTGTTTGGCGAAGAAATGACTGGTGAGAGATTAAGCTGGAAATCAATGATTCCATGTTGTTACAAAGTGGATGATGAGTTTGTAAAATCTAAGAAACAGGTGAAGAAACAGACTTCATTCCAGAGGCTAACACTTTTAGACTTTGATGATCCAAGTTCACCGTTATCGGCTGATGAACTCTCTAATTCATTCATTGGATCAAGCCTAATAAACTTTACATTTACTGATCTTAGAGAGGTAACACATAATTTTTCTTCTGCTAATTTTCTTGGTGAAGGAGGATTTGGACCTGTGTACAAGGGATTCGTCGATGACAAAGTTAGACCTGGATTGAAAGCTCAGGTTGTGGCTGTTAAGGTGCTGGATACAGATGGTCTACAAGGTCACAAGGAATGGCTGACAGAGATAATATTCCTGGGGCAATTGAGGCATCCACATCTGGTAAAATTGATTGGATACTGCTGGGAGGATGATAATAGACTTTTAGTCTATGAATTCTTGCCAAGAGGAAGCTTGGAGAATCAACTCTTTGGAAAATTTTCGATCACATTGTCGTGGTCCATAAGGATGAAGATAGCATTGGGAGCAGCAAAAGGTCTCGCGTTCCTTCATGAAGGAGACAAACCAGTCATATACAGGGACTTTAAGGCCTCAAACATCTTAATAGATTCAGATTACACTGCTAAACTTTCTGATTTTGGACTCGCAAAGGATGGGCCGGAAGGGGATGATACTCATGTTTCCACACGAATAATGGGAACACATGGCTATGCAGCCCCTGAATACATAATGACAGGTCATTTGACGACAATGAGTGATGTATACAGCTTTGGAGTAGTTCTGTTGGAACTGCTAACTGGTAAAAGGTCTTTGGATAAGTCGAGAAGAGAAGGAGAACATAATTTAGTTGAATGGTTAAGGCCTTATCTAAGAGATCCAAAGAGAATTGCTCGTGTGATGGATCGAAGACTTGAAGATGAATACCCTATGAAAGGGGCACAAACTGCAGCATTAGTAGCATACAAATGTTTAAATCACTATCCTAAGCCTAGGCCTACAATGGATGATGTAGTCAAGATTCTCGAAACTCTTCAAGATGAAAACAACAACATCGACACTTCAATCAGTGATCCAATGATAACGATGACATTGAGTAGTGATTTTAGCAGTGGAAGTGAGCAAAATGAGGATACTGCAGCACCAGAAAGGAATAGAAATAACAAGTACTTGAATAATGAGAGAAATCAAGGTTATGGCTGGAAACATCGACTCAATAGACAACGAATGGTGGCATCATACTCAGATACAGCTCTCTATCGAAGACATTGACATGGTAAAGGCATTGCAGCGAACAATATTAAGTAATATTGCACTTCAATTTATCGATGCTACTAAATATTAATGCAGTAAGCAGAGTATACTGAAGATATAATTTAAACAGCATACTAGTTTCCTGTTAAGGTATAAAAATGTAACATGATTTTCTCTTCTTTTTTCCTCTTCAGTTGTTAGATATGAAATTGAAAAAAGAAAACCAAGACTAAGCCAATTCTGTTTaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Les.5672 translated coding region predicted by ESTScan from UniGene Les.5672

MTGERLSWKSMIPCCYKVDDEFVKSKKQVKKQTSFQRLTLLDFDDPSSPLSADELSNSFIGSSLINFTFTDLREVTHNFSSANFLGEGGFGPVYKGFVDDKVRPGLKAQVVAVKVLDTDGLQGHKEWLTEIIFLGQLRHPHLVKLIGYCWEDDNRLLVYEFLPRGSLENQLFGKFSITLSWSIRMKIALGAAKGLAFLHEGDKPVIYRDFKASNILIDSDYTAKLSDFGLAKDGPEGDDTHVSTRIMGTHGYAAPEYIMTGHLTTMSDVYSFGVVLLELLTGKRSLDKSRREGEHNLVEWLRPYLRDPKRIARVMDRRLEDEYPMKGAQTAALVAYKCLNHYPKPRPTMDDVVKILETLQDENNNIDTSISDPMITMTLSSDFSSGSEQNEDTAAPERNRNNKYLNNGEIKVMAGNIDSIDNEWWHHTQIQLSIEDIDMVKALQRTILSNIALQFIDATKY

Domains

Domain Start-End Description Sequence

Seg: seg
22-35 seg

FVKSKKQVKKQTSF

superfamily: SSF56112
IPR011009
49-364 Protein kinase-like (PK-like)
Protein kinase-like domain

PLSADELSNSFIGSSLINFTFTDLREVTHNFSSANFLGEGGFGPVYKGFVDDKVRPGLKAQVVAVKVLDTDGLQGHKEWLTEIIFLGQLRHPHLVKLIGYCWEDDNRLLVYEFLPRGSLENQLFGKFSITLSWSIRMKIALGAAKGLAFLHEGDKPVIYRDFKASNILIDSDYTAKLSDFGLAKDGPEGDDTHVSTRIMGTHGYAAPEYIMTGHLTTMSDVYSFGVVLLELLTGKRSLDKSRREGEHNLVEWLRPYLRDPKRIARVMDRRLEDEYPMKGAQTAALVAYKCLNHYPKPRPTMDDVVKILETLQDENN

HMMPanther: PTHR24420:SF661
61-427 SUBFAMILY NOT NAMED

GSSLINFTFTDLREVTHNFSSANFLGEGGFGPVYKGFVDDKVRPGLKAQVVAVKVLDTDGLQGHKEWLTEIIFLGQLRHPHLVKLIGYCWEDDNRLLVYEFLPRGSLENQLFGKFSITLSWSIRMKIALGAAKGLAFLHEGDKPVIYRDFKASNILIDSDYTAKLSDFGLAKDGPEGDDTHVSTRIMGTHGYAAPEYIMTGHLTTMSDVYSFGVVLLELLTGKRSLDKSRREGEHNLVEWLRPYLRDPKRIARVMDRRLEDEYPMKGAQTAALVAYKCLNHYPKPRPTMDDVVKILETLQDENNNIDTSISDPMITMTLSSDFSSGSEQNEDTAAPERNRNNKYLNNGEIKVMAGNIDSIDNEWWHH

HMMPanther: PTHR24420
61-427 FAMILY NOT NAMED,FAMILY NOT NAMED

GSSLINFTFTDLREVTHNFSSANFLGEGGFGPVYKGFVDDKVRPGLKAQVVAVKVLDTDGLQGHKEWLTEIIFLGQLRHPHLVKLIGYCWEDDNRLLVYEFLPRGSLENQLFGKFSITLSWSIRMKIALGAAKGLAFLHEGDKPVIYRDFKASNILIDSDYTAKLSDFGLAKDGPEGDDTHVSTRIMGTHGYAAPEYIMTGHLTTMSDVYSFGVVLLELLTGKRSLDKSRREGEHNLVEWLRPYLRDPKRIARVMDRRLEDEYPMKGAQTAALVAYKCLNHYPKPRPTMDDVVKILETLQDENNNIDTSISDPMITMTLSSDFSSGSEQNEDTAAPERNRNNKYLNNGEIKVMAGNIDSIDNEWWHH

Gene3D: G3DSA:3.30.200.20
63-147 no description

SLINFTFTDLREVTHNFSSANFLGEGGFGPVYKGFVDDKVRPGLKAQVVAVKVLDTDGLQGHKEWLTEIIFLGQLRHPHLVKLIG

ProfileScan: PS50011
IPR000719
79-359 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSSANFLGEGGFGPVYKGFVDDKVRPGLKAQVVAVKVLDTDGLQGHKEWLTEIIFLGQLRHPHLVKLIGYCWEDDNRLLVYEFLPRGSLENQLFGKFSITLSWSIRMKIALGAAKGLAFLHEGDKPVIYRDFKASNILIDSDYTAKLSDFGLAKDGPEGDDTHVSTRIMGTHGYAAPEYIMTGHLTTMSDVYSFGVVLLELLTGKRSLDKSRREGEHNLVEWLRPYLRDPKRIARVMDRRLEDEYPMKGAQTAALVAYKCLNHYPKPRPTMDDVVKILETL

HMMSmart: SM00219
IPR020635
79-356 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSSANFLGEGGFGPVYKGFVDDKVRPGLKAQVVAVKVLDTDGLQGHKEWLTEIIFLGQLRHPHLVKLIGYCWEDDNRLLVYEFLPRGSLENQLFGKFSITLSWSIRMKIALGAAKGLAFLHEGDKPVIYRDFKASNILIDSDYTAKLSDFGLAKDGPEGDDTHVSTRIMGTHGYAAPEYIMTGHLTTMSDVYSFGVVLLELLTGKRSLDKSRREGEHNLVEWLRPYLRDPKRIARVMDRRLEDEYPMKGAQTAALVAYKCLNHYPKPRPTMDDVVKIL

HMMSmart: SM00220
IPR002290
79-359 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSSANFLGEGGFGPVYKGFVDDKVRPGLKAQVVAVKVLDTDGLQGHKEWLTEIIFLGQLRHPHLVKLIGYCWEDDNRLLVYEFLPRGSLENQLFGKFSITLSWSIRMKIALGAAKGLAFLHEGDKPVIYRDFKASNILIDSDYTAKLSDFGLAKDGPEGDDTHVSTRIMGTHGYAAPEYIMTGHLTTMSDVYSFGVVLLELLTGKRSLDKSRREGEHNLVEWLRPYLRDPKRIARVMDRRLEDEYPMKGAQTAALVAYKCLNHYPKPRPTMDDVVKILETL

HMMPfam: PF07714
IPR001245
83-356 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

NFLGEGGFGPVYKGFVDDKVRPGLKAQVVAVKVLDTDGLQGHKEWLTEIIFLGQLRHPHLVKLIGYCWEDDNRLLVYEFLPRGSLENQLFGKFSITLSWSIRMKIALGAAKGLAFLHEGDKPVIYRDFKASNILIDSDYTAKLSDFGLAKDGPEGDDTHVSTRIMGTHGYAAPEYIMTGHLTTMSDVYSFGVVLLELLTGKRSLDKSRREGEHNLVEWLRPYLRDPKRIARVMDRRLEDEYPMKGAQTAALVAYKCLNHYPKPRPTMDDVVKIL

Gene3D: G3DSA:1.10.510.10
148-367 no description

YCWEDDNRLLVYEFLPRGSLENQLFGKFSITLSWSIRMKIALGAAKGLAFLHEGDKPVIYRDFKASNILIDSDYTAKLSDFGLAKDGPEGDDTHVSTRIMGTHGYAAPEYIMTGHLTTMSDVYSFGVVLLELLTGKRSLDKSRREGEHNLVEWLRPYLRDPKRIARVMDRRLEDEYPMKGAQTAALVAYKCLNHYPKPRPTMDDVVKILETLQDENNNID

PatternScan: PS00108
IPR008271
205-217 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIYRDFKASNILI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox