PRGDB00080053 (Les.11524)

From PRG Wiki
Jump to: navigation, search
Les.11524
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 6528901 (AW218027)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Solanum lycopersicum

Comment?

EST296742 tomato flower buds, anthesis, Cornell University Lycopersicon esculentum cDNA clone cTOD6I7, mRNA sequence

DNA Sequence

GAGAAAGTAAGAGTAGATATATAGTTGAAGAAATTAAAATCATGGGGTGTTTTCCTTGTTCTGGAGATGGAGATACATCAGTGAAGAAACCAGAGAAAAAAATATTTCAAACTATTAGTAATCATAAATACAAAAGGGTTGAACAGCCACAGCCTAAACAAGTAGTTACGCCGGTGGCTAGTCAATTTAAAGTTGTGAAGAATGAAGACGCTAAAGTTGCAAACCGATCTATGTCTAAGAAAGATGGGGGTTATAGTAACATCTCTCCCACAGATGGAAAAACAGGTGGTGCTAAGGCGCAGAGGTTTAAATTCGATCAACTAATAGCTGCAACAGAAGATTTCAAGGAAGATTACTTCTTGGGAGAAGGAGGTTTTGGCAAAGTATATAAAGGTCATTTGGAGGATACTGGTGAGATTGTCGCCATCAAACAACTCGATCCAAATGGATGTCAAGGAGTTAGGGAGTTTGTTGTTGAAGTACAGACTCTAAGTAAAGCTGACCATGCTAATCTTGTTAAACTAATTGGTTGTTGTGCTGAGGGAGATCAGAGGCTATTAGTCTATGAGTATATGTCTCTTGGTTCGTTGGAAGACCATTTGTTTGACCCCTGGCCAAATC


Protein sequences

Name Description Sequence
Les.11524 translated coding region predicted by ESTScan from UniGene Les.11524

MGCFPCSGDGDTSVKKPEKKIFQTISNHKYKRVEQPQPKQVVTPVASQFKVVKNEDAKVANRSMSKKDGGYSNISPTDGKTGGAKAQRFKFDQLIAATEDFKEDYFLGEGGFGKVYKGHLEDTGEIVAIKQLDPNGCQGVREFVVEVQTLSKADHANLVKLIGCCAEGDQRLLVYEYMSLGSLEDHLFDPWPNX

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.30.200.20
85-178 no description

KAQRFKFDQLIAATEDFKEDYFLGEGGFGKVYKGHLEDTGEIVAIKQLDPNGCQGVREFVVEVQTLSKADHANLVKLIGCCAEGDQRLLVYEYM

HMMPanther: PTHR24420:SF799
85-190 SUBFAMILY NOT NAMED

KAQRFKFDQLIAATEDFKEDYFLGEGGFGKVYKGHLEDTGEIVAIKQLDPNGCQGVREFVVEVQTLSKADHANLVKLIGCCAEGDQRLLVYEYMSLGSLEDHLFDP

HMMPanther: PTHR24420
85-190 FAMILY NOT NAMED,FAMILY NOT NAMED

KAQRFKFDQLIAATEDFKEDYFLGEGGFGKVYKGHLEDTGEIVAIKQLDPNGCQGVREFVVEVQTLSKADHANLVKLIGCCAEGDQRLLVYEYMSLGSLEDHLFDP

superfamily: SSF56112
IPR011009
90-189 Protein kinase-like (PK-like)
Protein kinase-like domain

KFDQLIAATEDFKEDYFLGEGGFGKVYKGHLEDTGEIVAIKQLDPNGCQGVREFVVEVQTLSKADHANLVKLIGCCAEGDQRLLVYEYMSLGSLEDHLFD

ProfileScan: PS50011
IPR000719
101-194 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FKEDYFLGEGGFGKVYKGHLEDTGEIVAIKQLDPNGCQGVREFVVEVQTLSKADHANLVKLIGCCAEGDQRLLVYEYMSLGSLEDHLFDPWPNX

HMMPfam: PF07714
IPR001245
106-187 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

FLGEGGFGKVYKGHLEDTGEIVAIKQLDPNGCQGVREFVVEVQTLSKADHANLVKLIGCCAEGDQRLLVYEYMSLGSLEDHL

PatternScan: PS00107
IPR017441
107-130 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGKVYKGHLEDTGEIVAIK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox