PRGDB00080093 (Les.14352)

From PRG Wiki
Jump to: navigation, search
Les.14352
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 47105592 (BT014177)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Solanum lycopersicum

Comment?

Lycopersicon esculentum clone 133331F, mRNA sequence

DNA Sequence

GAATGGACTAATTATTTTTTATGTACACGCTATGACCAAACCCAAAAAAATTCTTGAGAACTTTTTGAAACCTTTTTTCTCAATCTCCAATAAAGGTATGCAAAAATTCTTGTGTAGGTACCCTTAATCTTGAtttttttttGGTTCTAATGCTGATTTTGGGTTTTTCTCTTGTTGTGAATTGACTAATCAAACAAAAAAGGGAAAAATGAGGAGGACTTAGAGAAAATTGCAGCACAAGAACAGAAGCAATTCCCTTTTGAAGTTCTTGTTTCTGCTACCAAAGATTTTCACCCAGATAACAAGCTTGGTGAAGGTGGATTTGGGCCTGTATTCAAGAAATCAGAAGCTTTTGTTGAAAAAAATTGAATCTTTTTGTGATGCTTGAAGAAAATGAATCTTTCTGTGATTTGGGGGAAATTAAGTGATGGGAGGCAAATAGCTGTAAAGAAGCTTTCACATAGTTCAAGGCAAGGGATGAAGGAATTCAAGAATGAAGCTAAGTTGTTGGCTCGTGTACAACACAGAAATGTGGTGAATTTGTTAGGGTACTGTGTACATGGAGTAGAGAAGTTGCTTGTGTATGAGTATGTTGCTAATGAGAGCCTTGACAAAATCCTCTTCAAATCTGCTAACAGAGATGCGCTCAGCTGGAAGCAACGGCATGACATAATTGTTGGCATTGCTAGAGGGTTGCTATACCTTCATGAAGGATCACATACTTGCATTATCCACCGTGACATAAAAGCTAGCAACATCCTACTTGATGACAAATGGGTGCCCAAGATTGCTGATTTCGGAATGGCTAGACTCTATCCTGAAGATAAAACACATGTTAACACCCGTGTAGCTGGTACTAATGGCTATATGGCGCCCGAGTACGTTATGTATGGACATCTATCAGTGAAGGCTGATGTATTCAGTTTCGGAGTTGTAATTCTGGAGCTCATAAGTGGCCAGAAGAATTCAACCTTTAACAGAGATCCTGATTCTCGAAGCCTTCTTGAATGGGCGTACAGGCTGTACAAGAAGGGTCGGAGCTGGGAGATTATGGACCCTGCACTGGCACAATCGGCTATCCCCGATGAGATAGCAATGTACATACAGATTGGCTTATTATGCATTCAATCGGATCCACCACTACGTCCAACCATACAACAGGTTGTGGTGATGCTATCGAAGAATCCTGGATCTCTTGATAGAGAACCAACTAGACCTGGATATCCCGGATCAAGAATTAGATCTCACAGACCAGGTGGTGGTACGTCACACACAGGTGGAACCTCGGGTGCATCCAATCCTTCCACATTCAGCTCATCGTCTAGTAGCAACACTGTTACTGCAACTGCAAGTTCATCCACACCTACAAGACGGAGATCGGACCCTCATGGTAAACGTCCTGTGAGAGATTAGGCGCGGCGTTGTTGAAGATATTTTCTTAATTCTTTTTGTGTATACATTCAATTTTTGTAGCATGTAAATTGGTTACAAATTGAGTATCAAAGAGTAATGATGAATCTTAGTGACAGTTAACATGTAAAAGAAGTGTATGTAGTTACTCTCAGGAAATAAAACTACCTGGCATAATaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Les.14352 translated coding region predicted by ESTScan from UniGene Les.14352

MNLSVIWGKLSDGRQIAVKKLSHSSRQGMKEFKNEAKLLARVQHRNVVNLLGYCVHGVEKLLVYEYVANESLDKILFKSANRDALSWKQRHDIIVGIARGLLYLHEGSHTCIIHRDIKASNILLDDKWVPKIADFGMARLYPEDKTHVNTRVAGTNGYMAPEYVMYGHLSVKADVFSFGVVILELISGQKNSTFNRDPDSRSLLEWAYRLYKKGRSWEIMDPALAQSAIPDEIAMYIQIGLLCIQSDPPLRPTIQQVVVMLSKNPGSLDREPTRPGYPGSRIRSHRPGGGTSHTGGTSGASNPSTFSSSSSSNTVTATASSSTPTRRRSDPHGKRPVRD

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-267 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

MNLSVIWGKLSDGRQIAVKKLSHSSRQGMKEFKNEAKLLARVQHRNVVNLLGYCVHGVEKLLVYEYVANESLDKILFKSANRDALSWKQRHDIIVGIARGLLYLHEGSHTCIIHRDIKASNILLDDKWVPKIADFGMARLYPEDKTHVNTRVAGTNGYMAPEYVMYGHLSVKADVFSFGVVILELISGQKNSTFNRDPDSRSLLEWAYRLYKKGRSWEIMDPALAQSAIPDEIAMYIQIGLLCIQSDPPLRPTIQQVVVMLSKNPGS

HMMSmart: SM00220
IPR002290
3-261 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LSVIWGKLSDGRQIAVKKLSHSSRQGMKEFKNEAKLLARVQHRNVVNLLGYCVHGVEKLLVYEYVANESLDKILFKSANRDALSWKQRHDIIVGIARGLLYLHEGSHTCIIHRDIKASNILLDDKWVPKIADFGMARLYPEDKTHVNTRVAGTNGYMAPEYVMYGHLSVKADVFSFGVVILELISGQKNSTFNRDPDSRSLLEWAYRLYKKGRSWEIMDPALAQSAIPDEIAMYIQIGLLCIQSDPPLRPTIQQVVVML

HMMSmart: SM00219
IPR020635
4-261 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

SVIWGKLSDGRQIAVKKLSHSSRQGMKEFKNEAKLLARVQHRNVVNLLGYCVHGVEKLLVYEYVANESLDKILFKSANRDALSWKQRHDIIVGIARGLLYLHEGSHTCIIHRDIKASNILLDDKWVPKIADFGMARLYPEDKTHVNTRVAGTNGYMAPEYVMYGHLSVKADVFSFGVVILELISGQKNSTFNRDPDSRSLLEWAYRLYKKGRSWEIMDPALAQSAIPDEIAMYIQIGLLCIQSDPPLRPTIQQVVVML

HMMPanther: PTHR24420:SF787
5-332 SUBFAMILY NOT NAMED

VIWGKLSDGRQIAVKKLSHSSRQGMKEFKNEAKLLARVQHRNVVNLLGYCVHGVEKLLVYEYVANESLDKILFKSANRDALSWKQRHDIIVGIARGLLYLHEGSHTCIIHRDIKASNILLDDKWVPKIADFGMARLYPEDKTHVNTRVAGTNGYMAPEYVMYGHLSVKADVFSFGVVILELISGQKNSTFNRDPDSRSLLEWAYRLYKKGRSWEIMDPALAQSAIPDEIAMYIQIGLLCIQSDPPLRPTIQQVVVMLSKNPGSLDREPTRPGYPGSRIRSHRPGGGTSHTGGTSGASNPSTFSSSSSSNTVTATASSSTPTRRRSDPH

HMMPanther: PTHR24420
5-332 FAMILY NOT NAMED,FAMILY NOT NAMED

VIWGKLSDGRQIAVKKLSHSSRQGMKEFKNEAKLLARVQHRNVVNLLGYCVHGVEKLLVYEYVANESLDKILFKSANRDALSWKQRHDIIVGIARGLLYLHEGSHTCIIHRDIKASNILLDDKWVPKIADFGMARLYPEDKTHVNTRVAGTNGYMAPEYVMYGHLSVKADVFSFGVVILELISGQKNSTFNRDPDSRSLLEWAYRLYKKGRSWEIMDPALAQSAIPDEIAMYIQIGLLCIQSDPPLRPTIQQVVVMLSKNPGSLDREPTRPGYPGSRIRSHRPGGGTSHTGGTSGASNPSTFSSSSSSNTVTATASSSTPTRRRSDPH

superfamily: SSF56112
IPR011009
5-261 Protein kinase-like (PK-like)
Protein kinase-like domain

VIWGKLSDGRQIAVKKLSHSSRQGMKEFKNEAKLLARVQHRNVVNLLGYCVHGVEKLLVYEYVANESLDKILFKSANRDALSWKQRHDIIVGIARGLLYLHEGSHTCIIHRDIKASNILLDDKWVPKIADFGMARLYPEDKTHVNTRVAGTNGYMAPEYVMYGHLSVKADVFSFGVVILELISGQKNSTFNRDPDSRSLLEWAYRLYKKGRSWEIMDPALAQSAIPDEIAMYIQIGLLCIQSDPPLRPTIQQVVVML

Gene3D: G3DSA:3.30.200.20
5-52 no description

VIWGKLSDGRQIAVKKLSHSSRQGMKEFKNEAKLLARVQHRNVVNLLG

HMMPfam: PF07714
IPR001245
12-260 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

DGRQIAVKKLSHSSRQGMKEFKNEAKLLARVQHRNVVNLLGYCVHGVEKLLVYEYVANESLDKILFKSANRDALSWKQRHDIIVGIARGLLYLHEGSHTCIIHRDIKASNILLDDKWVPKIADFGMARLYPEDKTHVNTRVAGTNGYMAPEYVMYGHLSVKADVFSFGVVILELISGQKNSTFNRDPDSRSLLEWAYRLYKKGRSWEIMDPALAQSAIPDEIAMYIQIGLLCIQSDPPLRPTIQQVVVM

Gene3D: G3DSA:1.10.510.10
53-260 no description

YCVHGVEKLLVYEYVANESLDKILFKSANRDALSWKQRHDIIVGIARGLLYLHEGSHTCIIHRDIKASNILLDDKWVPKIADFGMARLYPEDKTHVNTRVAGTNGYMAPEYVMYGHLSVKADVFSFGVVILELISGQKNSTFNRDPDSRSLLEWAYRLYKKGRSWEIMDPALAQSAIPDEIAMYIQIGLLCIQSDPPLRPTIQQVVVM

PatternScan: PS00108
IPR008271
112-124 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKASNILL

Seg: seg
288-329 seg

GGGTSHTGGTSGASNPSTFSSSSSSNTVTATASSSTPTRRRS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox