PRGDB00080098 (Les.14791)

From PRG Wiki
Jump to: navigation, search
Les.14791
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 6529013 (AW218139)
Gene Class Unknown
Domain Type LRR
Gene Species Solanum lycopersicum

Comment?

EST303320 tomato radicle, 5 d post-imbibition, Cornell University Lycopersicon esculentum cDNA clone cLEZ1G5, mRNA sequence

DNA Sequence

GGCCTCAAGAAAATTCCAAGTTGTGTTGAGATGGGATCCCTTAAGAGTCTCAAACTTTCTTGTCTTCCAAAATTGAGGGAATTGCCAGAAACCAAGGGGATGCACCGTTTATTGACGTTAGAGCTGACTAACTGTCAATACCTTGAGAAGCTTCCAAATTTTGATCAGATGGAATCCCTTGAGACTCTCAAACTTTCTTGTCTTCCAAAAGTCACTATATTTCCGCCACCAGACGGAATGCACTGTTTACAGGACATTGTTATCGAATATGTCCCGATAGTAGAGCTTCCAGCATCAATCGGGAATCTTCGTTCCCTCAAACAACTTAGATTAAGTCATTGTAAAGATCTAGTAAGCATTCCAAACAGCTTTTGTTGTCTGAAGAATCTAAGAGCCCTTCTTATCTACAATTGCAAAAGACTAATCTATTTGCCAGAAAAGATTGGTGACTTGAAACTGTTAAAGAAGCTAGTAGTATCTGGTACTTCAATTTCCCAGATACCAACTTCAGTTACAGATCTTCGTGAGCTAAGCTTCTTATCGTTTTCTCGTTGGTCTGGATACAGACAAGGTGCAACTTTTCTGTTCCCGCCTTCATCAGGTGTATCGTTGCCGTTGAGGGTGTTAAAGCTaaaaaaaaaCAGGCTATGTAGTGCAGAACATTTTCCAGATGTTGGAGGTTTATCTTCGTTAGCTCACTTGGATTTGACTAGAAATGATGAGAGTACCAATCAACTCTTTCTTTACTTAGACATAACAATTTGTGAGAAGCTTGCATTGCC


Protein sequences

Name Description Sequence
Les.14791 translated coding region predicted by ESTScan from UniGene Les.14791

GLKKIPSCVEMGSLKSLKLSCLPKLRELPETKGMHRLLTLELTNCQYLEKLPNFDQMESLETLKLSCLPKVTIFPPPDGMHCLQDIVIEYVPIVELPASIGNLRSLKQLRLSHCKDLVSIPNSFCCLKNLRALLIYNCKRLIYLPEKIGDLKLLKKLVVSGTSISQIPTSVTDLRELSFLSFSRWSGYRQGATFLFPPSSGVSLPLRVLKLKKNRLCSAEHFPDVGGLSSLAHLDLTRNDESTNQLFLYLDITICEKLALP


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-239 L domain-like,LRR

GLKKIPSCVEMGSLKSLKLSCLPKLRELPETKGMHRLLTLELTNCQYLEKLPNFDQMESLETLKLSCLPKVTIFPPPDGMHCLQDIVIEYVPIVELPASIGNLRSLKQLRLSHCKDLVSIPNSFCCLKNLRALLIYNCKRLIYLPEKIGDLKLLKKLVVSGTSISQIPTSVTDLRELSFLSFSRWSGYRQGATFLFPPSSGVSLPLRVLKLKKNRLCSAEHFPDVGGLSSLAHLDLTRN

HMMPanther: PTHR23155:SF252
2-247 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LKKIPSCVEMGSLKSLKLSCLPKLRELPETKGMHRLLTLELTNCQYLEKLPNFDQMESLETLKLSCLPKVTIFPPPDGMHCLQDIVIEYVPIVELPASIGNLRSLKQLRLSHCKDLVSIPNSFCCLKNLRALLIYNCKRLIYLPEKIGDLKLLKKLVVSGTSISQIPTSVTDLRELSFLSFSRWSGYRQGATFLFPPSSGVSLPLRVLKLKKNRLCSAEHFPDVGGLSSLAHLDLTRNDESTNQLF

HMMPanther: PTHR23155
2-247 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LKKIPSCVEMGSLKSLKLSCLPKLRELPETKGMHRLLTLELTNCQYLEKLPNFDQMESLETLKLSCLPKVTIFPPPDGMHCLQDIVIEYVPIVELPASIGNLRSLKQLRLSHCKDLVSIPNSFCCLKNLRALLIYNCKRLIYLPEKIGDLKLLKKLVVSGTSISQIPTSVTDLRELSFLSFSRWSGYRQGATFLFPPSSGVSLPLRVLKLKKNRLCSAEHFPDVGGLSSLAHLDLTRNDESTNQLF

Gene3D: G3DSA:3.80.10.10
2-240 no description

LKKIPSCVEMGSLKSLKLSCLPKLRELPETKGMHRLLTLELTNCQYLEKLPNFDQMESLETLKLSCLPKVTIFPPPDGMHCLQDIVIEYVPIVELPASIGNLRSLKQLRLSHCKDLVSIPNSFCCLKNLRALLIYNCKRLIYLPEKIGDLKLLKKLVVSGTSISQIPTSVTDLRELSFLSFSRWSGYRQGATFLFPPSSGVSLPLRVLKLKKNRLCSAEHFPDVGGLSSLAHLDLTRND

Seg: seg
13-25 seg

SLKSLKLSCLPKL

HMMPfam: PF00560
IPR001611
105-127 LRR_1
Leucine-rich repeat

SLKQLRLSHCKDLVSIPNSFCCL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox