PRGDB00080113 (Les.15616)

From PRG Wiki
Jump to: navigation, search
Les.15616
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 117722410 (DB684300)
Gene Class Unknown
Domain Type LRR
Gene Species Solanum lycopersicum

Comment?

DB684300 Solanum lycopersicum cv. Micro-Tom leaf Solanum lycopersicum cDNA clone LEFL1019BG08 5', mRNA sequence

DNA Sequence

AACATTCTGTTATTATTGATTCTTCTATTTCTAATTCAATTTTCTGTATCGCTTTCTTCCTCAAATGAGACTGACCAAAGAGCTCTACTAGCTTTCCATAATCTCATTACAACTCCTAATCATTTTTTGGCCAATAATTGGACCAAAAGTCCTTCTTTTTGCTCTTGGTTTGGTGTCACTTGCACTCCAAAAAGACAAAGGGTTGTTGCCTTGGATCTTCCTAATTTGCAACTTCAAGGCACAATTTCCCCGTCTTTGGCCAATTTGTCCTTCCTCAGTGTTCTCAATCTCCAGAATAACAGCTTCCACGGTGGCATCCCTTATGGACTTGGTCACCTGCCTCGCTTGCGAGTGATTGATGTTAAAAACAATCAGCTCAACGGAAGTATACCAACAAGTCTATTTCAAAACCGTAGAGTTGAAGTAATTTCATTGGGTGAAATGTGGAGAGGGCCATGGTATGTACCCCAACTCAGAGTCTTAAATCTCAGGAAAAATAGCCTCACCGGTATAATCCCCCCTTCTGTTGGAAATGCCACAAAAATGATGAACTTCAGTTTGTCTGGGAATAGAGTCAGCGGCAACATTCCAACGGAGGTCGGTAATCTGAGCCAGCTTGCATTTTTATCCTTGAGAGATAATCAATTAACAGGTCCCATTCCTCCAACACTGTTTAATATATCGTCTCTACTTTCTGTAGCTCTGGC


Protein sequences

Name Description Sequence
Les.15616 translated coding region predicted by ESTScan from UniGene Les.15616

NILLLLILLFLIQFSVSLSSSNETDQRALLAFHNLITTPNHFLANNWTKSPSFCSWFGVTCTPKRQRVVALDLPNLQLQGTISPSLANLSFLSVLNLQNNSFHGGIPYGLGHLPRLRVIDVKNNQLNGSIPTSLFQNRRVEVISLGEMWRGPWYVPQLRVLNLRKNSLTGIIPPSVGNATKMMNFSLSGNRVSGNIPTEVGNLSQLAFLSLRDNQLTGPIPPTLFNISSLLSVALA


Domains

Domain Start-End Description Sequence

Seg: seg
2-21 seg

ILLLLILLFLIQFSVSLSSS

HMMPanther: PTHR24420:SF474
2-230 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

ILLLLILLFLIQFSVSLSSSNETDQRALLAFHNLITTPNHFLANNWTKSPSFCSWFGVTCTPKRQRVVALDLPNLQLQGTISPSLANLSFLSVLNLQNNSFHGGIPYGLGHLPRLRVIDVKNNQLNGSIPTSLFQNRRVEVISLGEMWRGPWYVPQLRVLNLRKNSLTGIIPPSVGNATKMMNFSLSGNRVSGNIPTEVGNLSQLAFLSLRDNQLTGPIPPTLFNISSL

HMMPanther: PTHR24420
2-230 FAMILY NOT NAMED,FAMILY NOT NAMED

ILLLLILLFLIQFSVSLSSSNETDQRALLAFHNLITTPNHFLANNWTKSPSFCSWFGVTCTPKRQRVVALDLPNLQLQGTISPSLANLSFLSVLNLQNNSFHGGIPYGLGHLPRLRVIDVKNNQLNGSIPTSLFQNRRVEVISLGEMWRGPWYVPQLRVLNLRKNSLTGIIPPSVGNATKMMNFSLSGNRVSGNIPTEVGNLSQLAFLSLRDNQLTGPIPPTLFNISSL

superfamily: SSF52058
19-235 L domain-like,LRR

SSSNETDQRALLAFHNLITTPNHFLANNWTKSPSFCSWFGVTCTPKRQRVVALDLPNLQLQGTISPSLANLSFLSVLNLQNNSFHGGIPYGLGHLPRLRVIDVKNNQLNGSIPTSLFQNRRVEVISLGEMWRGPWYVPQLRVLNLRKNSLTGIIPPSVGNATKMMNFSLSGNRVSGNIPTEVGNLSQLAFLSLRDNQLTGPIPPTLFNISSLLSVAL

Gene3D: G3DSA:3.80.10.10
22-145 no description

NETDQRALLAFHNLITTPNHFLANNWTKSPSFCSWFGVTCTPKRQRVVALDLPNLQLQGTISPSLANLSFLSVLNLQNNSFHGGIPYGLGHLPRLRVIDVKNNQLNGSIPTSLFQNRRVEVISL

HMMPfam: PF08263
IPR013210
23-61 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

ETDQRALLAFHNLITTPNHFLANNWTKSPSFCSWFGVTC

HMMSmart: SM00369
IPR003591
113-137 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPRLRVIDVKNNQLNGSIPTSLFQN

HMMPfam: PF00560
IPR001611
115-137 LRR_1
Leucine-rich repeat

RLRVIDVKNNQLNGSIPTSLFQN

HMMSmart: SM00369
IPR003591
155-179 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

VPQLRVLNLRKNSLTGIIPPSVGNA

Gene3D: G3DSA:3.80.10.10
156-233 no description

PQLRVLNLRKNSLTGIIPPSVGNATKMMNFSLSGNRVSGNIPTEVGNLSQLAFLSLRDNQLTGPIPPTLFNISSLLSV

HMMPfam: PF00560
IPR001611
157-177 LRR_1
Leucine-rich repeat

QLRVLNLRKNSLTGIIPPSVG

HMMSmart: SM00369
IPR003591
203-227 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSQLAFLSLRDNQLTGPIPPTLFNI

HMMPfam: PF00560
IPR001611
206-225 LRR_1
Leucine-rich repeat

LAFLSLRDNQLTGPIPPTLF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox