PRGDB00080146 (Les.18025)

From PRG Wiki
Jump to: navigation, search
Les.18025
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 117725341 (DB710533)
Gene Class Unknown
Domain Type LRR
Gene Species Solanum lycopersicum

Comment?

DB710533 Solanum lycopersicum cv. Micro-Tom fruit Solanum lycopersicum cDNA clone LEFL2005J08 5', mRNA sequence

DNA Sequence

GTTACTAGCAAAGTATTCTCTTCACTTCAGTTTTTCACTGTTTTCTACCTCTTTACAGTTGCATTTGCTTCGACTGAGGAGGCAACTGCCCTCTTGAAATGGAAAGCAACTTTCAAGAACCAGAATAATTCCTTTTTGGCTTCATGGACGACAAGTTCTAATGCATGCAAGGACTGGTATGGAGTTGTATGCTTGAATGGTAGGGTAAACACGTTGAATATTACAAATGCCAGTGTCATTGGTACACTTTATGCTTTTCCATTTTCATCCCTCCCTTTTCTCGAGAATCTTGATCTTAGCAACAACAATATCTCTGGTACCATTCCACCTGAGATTGGTAATCTCACAAATCTTGTCTATCTTGACTTGAACACCAATCAGATTTCAGGAACAATTCCACCACAAATCGGTTCACTAGCCAAGCTTCAGATCATCCGCATATTTAACAATCATTTAAATGGCTTTATTCCTGAAGAAATAGGTTACCTAAGGTCTCTTACTAAGCTATCTTTGGGTATCAACTTTCTTAGTGGTTCTATTCCTGCTTCATTGGGCAATATGACCAACTTGTCTTTTTTATTTCTTTATGAAAATCAGCTTTCTGGCTTTATTCCTGAANAAATAGGTTACCTAAGGTCTCTTACTAAGCTATCTTTGGATATCAACTTTCTTAGTGGTTCCATTCCTGCTTCATTGGGGAATCTGAACAACTTGTCTTTTTTGNATCTTTANNNAATCAGCTTTCTGGCTCNNNTCCTGANAANTA


Protein sequences

Name Description Sequence
Les.18025 translated coding region predicted by ESTScan from UniGene Les.18025

VTSKVFSSLQFFTVFYLFTVAFASTEEATALLKWKATFKNQNNSFLASWTTSSNACKDWYGVVCLNGRVNTLNITNASVIGTLYAFPFSSLPFLENLDLSNNNISGTIPPEIGNLTNLVYLDLNTNQISGTIPPQIGSLAKLQIIRIFNNHLNGFIPEEIGYLRSLTKLSLGINFLSGSIPASLGNMTNLSFLFLYENQLSGFIPEXIGYLRSLTKLSLDINFLSGSIPASLGNLNNLSFLXLXXISFLAXXLXXX


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
9-243 FAMILY NOT NAMED,FAMILY NOT NAMED

LQFFTVFYLFTVAFASTEEATALLKWKATFKNQNNSFLASWTTSSNACKDWYGVVCLNGRVNTLNITNASVIGTLYAFPFSSLPFLENLDLSNNNISGTIPPEIGNLTNLVYLDLNTNQISGTIPPQIGSLAKLQIIRIFNNHLNGFIPEEIGYLRSLTKLSLGINFLSGSIPASLGNMTNLSFLFLYENQLSGFIPEXIGYLRSLTKLSLDINFLSGSIPASLGNLNNLSFLXL

superfamily: SSF52058
21-243 L domain-like,LRR

AFASTEEATALLKWKATFKNQNNSFLASWTTSSNACKDWYGVVCLNGRVNTLNITNASVIGTLYAFPFSSLPFLENLDLSNNNISGTIPPEIGNLTNLVYLDLNTNQISGTIPPQIGSLAKLQIIRIFNNHLNGFIPEEIGYLRSLTKLSLGINFLSGSIPASLGNMTNLSFLFLYENQLSGFIPEXIGYLRSLTKLSLDINFLSGSIPASLGNLNNLSFLXL

Gene3D: G3DSA:3.80.10.10
26-244 no description

EEATALLKWKATFKNQNNSFLASWTTSSNACKDWYGVVCLNGRVNTLNITNASVIGTLYAFPFSSLPFLENLDLSNNNISGTIPPEIGNLTNLVYLDLNTNQISGTIPPQIGSLAKLQIIRIFNNHLNGFIPEEIGYLRSLTKLSLGINFLSGSIPASLGNMTNLSFLFLYENQLSGFIPEXIGYLRSLTKLSLDINFLSGSIPASLGNLNNLSFLXLX

HMMPfam: PF08263
IPR013210
26-64 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

EEATALLKWKATFKNQNNSFLASWTTSSNACKDWYGVVC

HMMSmart: SM00369
IPR003591
91-114 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPFLENLDLSNNNISGTIPPEIGN

ProfileScan: PS51450
IPR001611
93-115 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLENLDLSNNNISGTIPPEIGNL

FPrintScan: PR00019
94-107 LEURICHRPT,Leucine-rich repeat signature

LENLDLSNNNISGT

HMMPfam: PF12799
94-129 LRR_4,Leucine Rich repeats (2 copies)

LENLDLSNNNISGTIPPEIGNLTNLVYLDLNTNQIS

FPrintScan: PR00019
115-128 LEURICHRPT,Leucine-rich repeat signature

LTNLVYLDLNTNQI

HMMSmart: SM00369
IPR003591
115-139 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTNLVYLDLNTNQISGTIPPQIGSL

ProfileScan: PS51450
IPR001611
117-139 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVYLDLNTNQISGTIPPQIGSL

HMMSmart: SM00369
IPR003591
163-187 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LRSLTKLSLGINFLSGSIPASLGNM

ProfileScan: PS51450
IPR001611
165-187 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTKLSLGINFLSGSIPASLGNM

ProfileScan: PS51450
IPR001611
189-211 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSFLFLYENQLSGFIPEXIGYL

HMMSmart: SM00369
IPR003591
211-235 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LRSLTKLSLDINFLSGSIPASLGNL

ProfileScan: PS51450
IPR001611
213-236 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTKLSLDINFLSGSIPASLGNLN

Seg: seg
230-253 seg

ASLGNLNNLSFLXLXXISFLAXXL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox