PRGDB00080150 (Les.18369)

From PRG Wiki
Jump to: navigation, search
Les.18369
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 117725366 (DB710556)
Gene Class Unknown
Domain Type LRR
Gene Species Solanum lycopersicum

Comment?

DB710556 Solanum lycopersicum cv. Micro-Tom fruit Solanum lycopersicum cDNA clone LEFL2005K10 5', mRNA sequence

DNA Sequence

ATCCTAGAACAGTTACATGGAATAAGAGCGCCGATTGTTGTTCATGGGATGGAGTTCATTGTGACGAAATGACGGGACAAGTGACTAAGCTTGACCTCGCTAACAACAGACTTCGGGGTGAGTTTCATTCCAACAGTAGCCTCTTTAAGCTCACCAATCTCAAATGGCTTGATTTGTCTGGAAATAATTTTTCTGGATCACTCATTTCACCTAAATTTGGTGAGCTTTCTAGTTTAACGCATCTTGATTTGTCGTATTCAAATTTTACAAGTATAATCCCGTCAGAAATATCTCGTCTTTCTAAGTTACATGTTCTTCGTCTCCAGGATAGTCAATTAAGATTCGAACCTCACAATTTCGAACTGCTCCTTAAGAACTTGACCCGATTAAGAGAGCTCCACCTTAGCGATGTAAACATCTCTTCCGCTATTCCTCTGAATTTCTCTTCTTGTTTAACAAATCTAAGACTTTGGAACACGCAGTTATACGGGATGCTGCCGGAAAGTGTTTTTCACCTTTCCAACTTAGAATCTCTTGATTTAGCAGAAACTCCGCAGCTCACTGTTAGGTTTCCCACAACCAAATGGAATAGCAGTGCATCACTCGTGAAGTTAGTTCTATGGGGTGTGAATGCTATTGATAGGATACCTGAATCATTTGGTCATCTAACTTCACTGCGTANANTNNAGTTGTCTTTTTGTAATCTCTCNNNTCTATTCCTAAACCTCTATGGAATCTCACCAATATAGAGGTATNGAACCTGGGTGANANCNTCTTGAAG


Protein sequences

Name Description Sequence
Les.18369 translated coding region predicted by ESTScan from UniGene Les.18369

XPRTVTWNKSADCCSWDGVHCDEMTGQVTKLDLANNRLRGEFHSNSSLFKLTNLKWLDLSGNNFSGSLISPKFGELSSLTHLDLSYSNFTSIIPSEISRLSKLHVLRLQDSQLRFEPHNFELLLKNLTRLRELHLSDVNISSAIPLNFSSCLTNLRLWNTQLYGMLPESVFHLSNLESLDLAETPQLTVRFPTTKWNSSASLVKLVLWGVNAIDRIPESFGHLTSLRXXXLSFCNLSXLFLNLYGISPI


Domains

Domain Start-End Description Sequence

HMMPfam: PF08263
IPR013210
4-22 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

TVTWNKSADCCSWDGVHCD

HMMPanther: PTHR24420
6-237 FAMILY NOT NAMED,FAMILY NOT NAMED

TWNKSADCCSWDGVHCDEMTGQVTKLDLANNRLRGEFHSNSSLFKLTNLKWLDLSGNNFSGSLISPKFGELSSLTHLDLSYSNFTSIIPSEISRLSKLHVLRLQDSQLRFEPHNFELLLKNLTRLRELHLSDVNISSAIPLNFSSCLTNLRLWNTQLYGMLPESVFHLSNLESLDLAETPQLTVRFPTTKWNSSASLVKLVLWGVNAIDRIPESFGHLTSLRXXXLSFCNLS

superfamily: SSF52058
6-241 L domain-like,LRR

TWNKSADCCSWDGVHCDEMTGQVTKLDLANNRLRGEFHSNSSLFKLTNLKWLDLSGNNFSGSLISPKFGELSSLTHLDLSYSNFTSIIPSEISRLSKLHVLRLQDSQLRFEPHNFELLLKNLTRLRELHLSDVNISSAIPLNFSSCLTNLRLWNTQLYGMLPESVFHLSNLESLDLAETPQLTVRFPTTKWNSSASLVKLVLWGVNAIDRIPESFGHLTSLRXXXLSFCNLSXLFL

Gene3D: G3DSA:3.80.10.10
7-238 no description

WNKSADCCSWDGVHCDEMTGQVTKLDLANNRLRGEFHSNSSLFKLTNLKWLDLSGNNFSGSLISPKFGELSSLTHLDLSYSNFTSIIPSEISRLSKLHVLRLQDSQLRFEPHNFELLLKNLTRLRELHLSDVNISSAIPLNFSSCLTNLRLWNTQLYGMLPESVFHLSNLESLDLAETPQLTVRFPTTKWNSSASLVKLVLWGVNAIDRIPESFGHLTSLRXXXLSFCNLSX

HMMPfam: PF13855
28-88 LRR_8,Leucine rich repeat

VTKLDLANNRLRGEFHSNSSLFKLTNLKWLDLSGNNFSGSLISPKFGELSSLTHLDLSYSN

Seg: seg
121-135 seg

ELLLKNLTRLRELHL

HMMPfam: PF00560
IPR001611
129-151 LRR_1
Leucine-rich repeat

RLRELHLSDVNISSAIPLNFSSC

Seg: seg
225-243 seg

SLRXXXLSFCNLSXLFLNL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox