PRGDB00080175 (Les.19320)

From PRG Wiki
Jump to: navigation, search
Les.19320
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 83630760 (DQ304484)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Solanum lycopersicum

Comment?

Solanum lycopersicum NRC1 mRNA, complete cds

DNA Sequence

GAATTCGGCACGAGGCTTCTTCTGAGCATAATTCTCTTCTTCTCCAAGAAATCAATCGaaaaaaaaaaaaaaaGGAAAACAATATGGTTGATGTAGGGGTTGAATTTCTGTTAGAGAACTTGAAGCAATTGGTACTGGACAATGTGGAGTTAATCGGAGGAGCTAAAGATGAAATCGAGAATCTGCGTGATGATTTGAGTGAATTCAATGCCTTTCTCAAGCAAGCTGCAATGGTCCGCAGCGAAAACCCAGTTCTCAAAGAACTAGTGAGGAGTATCAGAAAAGTGGTGAATCGTGCTGAAGATGCTGTTGATAAATTTGTAATTGAAGCTAAAGTTCATAAAGACAAAGGGTTTAAAGGGGTTTTCGATAAACCTGGACATTATAGAAGAGTGAGGGATGCAGCTGTGGAGATTAAAGGTATCAGAGATAAAATGAGAGAAATTCGGCAAAATAAGGCACATGGCCTTCAGGCTCTACTTCAAGATCATGATGATTCAATCAGCAGAGGTGGAGAAGAGAGACAGCCTCCTGTGGTTGAGGAAGATGATGTGGTGGGCTTTGACGATGAGGCGCAGACGGTAATCGACCGTCTTCTTGAAGGATCAGGTGATTTAGAGGTTATTCCAGTAGTTGGAATGCCTGGTCTTGGCAAAACTACACTAGCCACTAAGATCTTCAAGCATCCGAAGATTGAGTACGAGTTCTTTACTAGACTTTGGCTTTACGTTTCCCAATCATACAAGACAAGAGAATTATATCTTAACATCATCAGTAAATTCACCGGAAACACCAAACATTGCCGTGATATGTCTGAAAAGGATTTAGCTCTTAAGGTACAAGAGATTTTGGAAGAAGGAGGAAAATACTTGATTGTCTTGGATGATGTCTGGTCGACAGATGCTTGGGATCGTATCAAGATTGCTTTCCCGAAAAATGACAAGGGCAATAGAGTATTGTTGACTACTCGAGACCACCGTGTTGCAAGATATTGCAATAGGAGTCCACATGATTTAAAATTTCTGACTGATGAAGAGAGTTGGATTTTACTGGAGAAAAGAGCTTTTCACAAAGCTAAATGTCTCCCCGAATTGGAAACAAACGGAAAAAGCATAGCCAGGAAGTGTAAAGGACTACCCCTTGCTATTGTGGTGATTGCAGGAGCTCTAATTGGGAAAAGCAAAACAATAAAGGAATGGGAGCAAGTGGATCAGAGTGTGGGCGAACATTTCATAAATAGAGATCAGCCAAATAGTTGTGATAAATTGGTACGGATGAGTTATGATGTTTTGCCTTATGACTGGAAAGCTTGCTTTTTATACTTCGGTACATTCCCCAGAGGCTATTTAATCCCTGCCAGGAAATTGATCCGCTTATGGATCGCGGAAGGGTTTATCCAGTACAGAGGGGACTTATCCCCTGAGTGTAAAGCAGAGGAGTACTTGAATGAACTCGTAAATAGAAACTTAGTGATGGTAATGCAAAGGACGGTTGATGGACAAATCAAAACTTGTCGTGTTCATGACATGTTGTATGAGTTTTGCTGGCAAGAGGCTACGACAGAGGAAAATCTTTTCCATGAAGTAAAATTCGGTGGTGAGCAATCTGTTCGTGAAGTATCCACTCATCGTCGCTTGTGCATTCATTCCTCTGTTGTGGAGTTCATTTCTAAGAAGCCCTCTGGTGAGCATGTTAGGTCGTTCCTATGTTTTTCTCCAGAAAAAATTGACACTCCCCCAACTGTCAGTGCAAACATATCAAAAGCCTTTCCATTGCTAAGGGTGTTTGATACTGAATCCATCAAAATCAATCGCTTTTGCAAGGAGTTCTTTCAATTGTATCATCTGAGGTATATTGCTTTCTCATTTGACTCGATTAAAGTCATTCCGAAACATGTTGGGGAACTTTGGAACGTACAAACCCTCATTGTCAACACACAACAGATCAACCTTGATATTCAAGCAGACATATTGAACATGCCCCGGCTGAGGCATCTGCTCACCAACACGTCTGCTAAATTGCCTGCGCTTGCTAACCCCAAAACAAGTAAGACTACCTTGGTAAATCAAAGCCTGCAAACCCTCTCCACAATTGCACCAGAAAGCTGCACTGAGTATGTTCTCTCGAGGGCTCCAAACTTGAAAAAACTGGGCATTCGTGGAAAAATAGCTAAGCTAATGGAACCAAGTCAGTCTGTATTGTTGAACAATGTTAAGAGGCTGCAATTTCTTGAGAACTTGAAGCTGATAAATGTTGGTCAGATTGATCAGACACAATTACGCCTTCCTCCAGCATCTATATTTCCAACAAAGTTGAGGAAGCTGACTTTATTAGATACCTGGTTGGAGTGGGATGATATGTCTGTATTGAAACAGCTGGAGAACCTTCAAGTCTTGAAGCTGAAGGACAATGCATTTAAGGGAGAGAACTGGGAACTAAATGATGGAGGTTTTCCTTTCCTACAAGTGTTATGCATTGAAAGGGCAAACTTAGTTTCTTGGAATGCTTCAGGTGATCACTTCCCGAGACTTAAACATCTTCACATATCATGTGATAAACTTGAGAAGATCCCCATTGGCCTGGCTGATATATGCAGCCTCCAAGTGATGGATTTGCGAAATTCCACTAAATCAGCAGCAAAATCTGCCAGAGAGATACAAGCCaaaaaaaaCAAGCTGCAACCTGCTAAATCCCAGAAGTTCGAGCTTTCTGTATTCCCTCCTGATTCTGATGTACAGACAGCTTCTTAGAAAGGTCTAAAATAACCACATGCTGCAGGTTCAACCAGCCTGGTTGGCGCGCATGGTTTTTGCTTCATTTGGATCACTGCTTTCACAGTGAAACCTATTGCATTTCATAAGTGGAACGACTGATCCACGGTTTTGCAACTCTTTGGTTTCTTACTGTATTTGATGTGAGTTCATGTTTTATTGATTGTGGATGCAATGTGTCATCATAGCCAAGGAATAAGAACCAAATGTAACGTTCAAGAAATATCAGACATTGTTTCTTATAAGTTATACCACTCTGAATTTTCTCCTTTTAGATACAACAGCAGAACAAGTCACTTGTTTTGATTCATACACAATTTGATCATGTGTTATTATTTAAACAGCACTTTTGGTaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Les.19320 translated coding region predicted by ESTScan from UniGene Les.19320

MVDVGVEFLLENLKQLVLDNVELIGGAKDEIENLRDDLSEFNAFLKQAAMVRSENPVLKELVRSIRKVVNRAEDAVDKFVIEAKVHKDKGFKGVFDKPGHYRRVRDAAVEIKGIRDKMREIRQNKAHGLQALLQDHDDSISRGGEERQPPVVEEDDVVGFDDEAQTVIDRLLEGSGDLEVIPVVGMPGLGKTTLATKIFKHPKIEYEFFTRLWLYVSQSYKTRELYLNIISKFTGNTKHCRDMSEKDLALKVQEILEEGGKYLIVLDDVWSTDAWDRIKIAFPKNDKGNRVLLTTRDHRVARYCNRSPHDLKFLTDEESWILLEKRAFHKAKCLPELETNGKSIARKCKGLPLAIVVIAGALIGKSKTIKEWEQVDQSVGEHFINRDQPNSCDKLVRMSYDVLPYDWKACFLYFGTFPRGYLIPARKLIRLWIAEGFIQYRGDLSPECKAEEYLNELVNRNLVMVMQRTVDGQIKTCRVHDMLYEFCWQEATTEENLFHEVKFGGEQSVREVSTHRRLCIHSSVVEFISKKPSGEHVRSFLCFSPEKIDTPPTVSANISKAFPLLRVFDTESIKINRFCKEFFQLYHLRYIAFSFDSIKVIPKHVGELWNVQTLIVNTQQINLDIQADILNMPRLRHLLTNTSAKLPALANPKTSKTTLVNQSLQTLSTIAPESCTEYVLSRAPNLKKLGIRGKIAKLMEPSQSVLLNNVKRLQFLENLKLINVGQIDQTQLRLPPASIFPTKLRKLTLLDTWLEWDDMSVLKQLENLQVLKLKDNAFKGENWELNDGGFPFLQVLCIERANLVSWNASGDHFPRLKHLHISCDKLEKIPIGLADICSLQVMDLRNSTKSAAKSAREIQAKKNKLQPAKSQKFELSVFPPDSDVQTAS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF14
6-486 PTHR11017:SF14

VEFLLENLKQLVLDNVELIGGAKDEIENLRDDLSEFNAFLKQAAMVRSENPVLKELVRSIRKVVNRAEDAVDKFVIEAKVHKDKGFKGVFDKPGHYRRVRDAAVEIKGIRDKMREIRQNKAHGLQALLQDHDDSISRGGEERQPPVVEEDDVVGFDDEAQTVIDRLLEGSGDLEVIPVVGMPGLGKTTLATKIFKHPKIEYEFFTRLWLYVSQSYKTRELYLNIISKFTGNTKHCRDMSEKDLALKVQEILEEGGKYLIVLDDVWSTDAWDRIKIAFPKNDKGNRVLLTTRDHRVARYCNRSPHDLKFLTDEESWILLEKRAFHKAKCLPELETNGKSIARKCKGLPLAIVVIAGALIGKSKTIKEWEQVDQSVGEHFINRDQPNSCDKLVRMSYDVLPYDWKACFLYFGTFPRGYLIPARKLIRLWIAEGFIQYRGDLSPECKAEEYLNELVNRNLVMVMQRTVDGQIKTCRVHDMLYEF

HMMPanther: PTHR11017
6-486 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VEFLLENLKQLVLDNVELIGGAKDEIENLRDDLSEFNAFLKQAAMVRSENPVLKELVRSIRKVVNRAEDAVDKFVIEAKVHKDKGFKGVFDKPGHYRRVRDAAVEIKGIRDKMREIRQNKAHGLQALLQDHDDSISRGGEERQPPVVEEDDVVGFDDEAQTVIDRLLEGSGDLEVIPVVGMPGLGKTTLATKIFKHPKIEYEFFTRLWLYVSQSYKTRELYLNIISKFTGNTKHCRDMSEKDLALKVQEILEEGGKYLIVLDDVWSTDAWDRIKIAFPKNDKGNRVLLTTRDHRVARYCNRSPHDLKFLTDEESWILLEKRAFHKAKCLPELETNGKSIARKCKGLPLAIVVIAGALIGKSKTIKEWEQVDQSVGEHFINRDQPNSCDKLVRMSYDVLPYDWKACFLYFGTFPRGYLIPARKLIRLWIAEGFIQYRGDLSPECKAEEYLNELVNRNLVMVMQRTVDGQIKTCRVHDMLYEF

superfamily: SSF52540
140-386 SSF52540

ISRGGEERQPPVVEEDDVVGFDDEAQTVIDRLLEGSGDLEVIPVVGMPGLGKTTLATKIFKHPKIEYEFFTRLWLYVSQSYKTRELYLNIISKFTGNTKHCRDMSEKDLALKVQEILEEGGKYLIVLDDVWSTDAWDRIKIAFPKNDKGNRVLLTTRDHRVARYCNRSPHDLKFLTDEESWILLEKRAFHKAKCLPELETNGKSIARKCKGLPLAIVVIAGALIGKSKTIKEWEQVDQSVGEHFINR

HMMPfam: PF00931
IPR002182
161-440 NB-ARC,NBS
NB-ARC

DDEAQTVIDRLLEGSGDLEVIPVVGMPGLGKTTLATKIFKHPKIEYEFFTRLWLYVSQSYKTRELYLNIISKFTGNTKHCRDMSEKDLALKVQEILEEGGKYLIVLDDVWSTDAWDRIKIAFPKNDKGNRVLLTTRDHRVARYCNRSPHDLKFLTDEESWILLEKRAFHKAKCLPELETNGKSIARKCKGLPLAIVVIAGALIGKSKTIKEWEQVDQSVGEHFINRDQPNSCDKLVRMSYDVLPYDWKACFLYFGTFPRGYLIPARKLIRLWIAEGFIQY

Gene3D: G3DSA:3.40.50.300
176-299 G3DSA:3.40.50.300

GDLEVIPVVGMPGLGKTTLATKIFKHPKIEYEFFTRLWLYVSQSYKTRELYLNIISKFTGNTKHCRDMSEKDLALKVQEILEEGGKYLIVLDDVWSTDAWDRIKIAFPKNDKGNRVLLTTRDHR

FPrintScan: PR00364
IPR000767
180-195 DISEASERSIST
Disease resistance protein

VIPVVGMPGLGKTTLA

FPrintScan: PR00364
IPR000767
256-270 DISEASERSIST
Disease resistance protein

LEEGGKYLIVLDDVW

FPrintScan: PR00364
IPR000767
348-362 DISEASERSIST
Disease resistance protein

CKGLPLAIVVIAGAL

superfamily: SSF52058
478-846 SSF52058,LRR

RVHDMLYEFCWQEATTEENLFHEVKFGGEQSVREVSTHRRLCIHSSVVEFISKKPSGEHVRSFLCFSPEKIDTPPTVSANISKAFPLLRVFDTESIKINRFCKEFFQLYHLRYIAFSFDSIKVIPKHVGELWNVQTLIVNTQQINLDIQADILNMPRLRHLLTNTSAKLPALANPKTSKTTLVNQSLQTLSTIAPESCTEYVLSRAPNLKKLGIRGKIAKLMEPSQSVLLNNVKRLQFLENLKLINVGQIDQTQLRLPPASIFPTKLRKLTLLDTWLEWDDMSVLKQLENLQVLKLKDNAFKGENWELNDGGFPFLQVLCIERANLVSWNASGDHFPRLKHLHISCDKLEKIPIGLADICSLQVMDLRN

Gene3D: G3DSA:3.80.10.10
562-714 G3DSA:3.80.10.10

FPLLRVFDTESIKINRFCKEFFQLYHLRYIAFSFDSIKVIPKHVGELWNVQTLIVNTQQINLDIQADILNMPRLRHLLTNTSAKLPALANPKTSKTTLVNQSLQTLSTIAPESCTEYVLSRAPNLKKLGIRGKIAKLMEPSQSVLLNNVKRLQ

Gene3D: G3DSA:3.80.10.10
726-847 G3DSA:3.80.10.10

QIDQTQLRLPPASIFPTKLRKLTLLDTWLEWDDMSVLKQLENLQVLKLKDNAFKGENWELNDGGFPFLQVLCIERANLVSWNASGDHFPRLKHLHISCDKLEKIPIGLADICSLQVMDLRNS

FPrintScan: PR00364
IPR000767
834-850 DISEASERSIST
Disease resistance protein

ADICSLQVMDLRNSTKS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox