PRGDB00080442 (Mgu.5155)

From PRG Wiki
Jump to: navigation, search
Mgu.5155
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 238201423 (GR076251)
Gene Class Unknown
Domain Type
Gene Species Cucumis x hytivus

Comment?

CCIF12398.b1 CCIF Mimulus guttatus IM62 leaves (H) Mimulus guttatus cDNA clone CCIF12398 5', mRNA sequence

DNA Sequence

ATTTCTCTCTCTCTCTCTCACACAAACACACACACGAAAGGTGTGAGAGAGGTGGAATTTGACGACGGAAATGGAAAAGGTGGTTTGTGTAACGGGGGCATCCGGTTACATAGCGTCGTGGCTGGTTAAGTTTTTGCTTCACCGTGGTTACACCGTTAAGGCCACCGTCCGCAACCTCAGTGATCCAAGAAAGGTTGAACATCTAATGGCACTTGAAGGAGCCAAGGAAAGATTGTTTTTGTATCAAGCCGACTTACTCGAAGAAGGATCTTTCGATTCGGTAGTTGATGCCTGCGAATGTGTTTTTCACACAGCATCTCCCGTTTTCCTTTCAGTTTCCGATCCACGGACAGAGTTGATAGATCCTGCGGTGAAGGGAACGATTAACGTTCTTAGATCATGCAAGAAAGTACCGTCGATCAAACGAGTTGTTATTACATCTTCAATGGCTTCCGTTATGTTCAATCATAGTCCACTAAATTCTGATGCTATAGTCGACGAAACTTGGTATTCTGATCCGTTGTTCTGCGAGGAAAAAAAGGAATGGTATGCACTGTCGAAAACTCTAGCAGAGAAGGCTGCATGGAAATTTGCAGAAGAAAACGGGCTCGATGTTGTTACGTTACACCCGGGTTTCGTTATCGGTCCTCTACTTCAGCCAACTCTCAATTTGACCTCCGAGGCTCTTTTGAATCTCGTTAGAGAAAGGAAAACAATTATGGACAAGTGGAATATACCGATACGTTGACGTGAGAGACGTTGCTCTTGCGCACATTCTAGCGTTTGAGAATCCCTCTGCA


Protein sequences

Name Description Sequence
Mgu.5155 translated coding region predicted by ESTScan from UniGene Mgu.5155

MEKVVCVTGASGYIASWLVKFLLHRGYTVKATVRNLSDPRKVEHLMALEGAKERLFLYQADLLEEGSFDSVVDACECVFHTASPVFLSVSDPRTELIDPAVKGTINVLRSCKKVPSIKRVVITSSMASVMFNHSPLNSDAIVDETWYSDPLFCEEKKEWYALSKTLAEKAAWKFAEENGLDVVTLHPGFVIGPLLQPTLNLTSEALLNLVRERKTIMDKWNIPILDVRDVALAHILAFENPSA

Domains

Domain Start-End Description Sequence

superfamily: SSF51735
1-243 NAD(P)-binding Rossmann-fold domains

MEKVVCVTGASGYIASWLVKFLLHRGYTVKATVRNLSDPRKVEHLMALEGAKERLFLYQADLLEEGSFDSVVDACECVFHTASPVFLSVSDPRTELIDPAVKGTINVLRSCKKVPSIKRVVITSSMASVMFNHSPLNSDAIVDETWYSDPLFCEEKKEWYALSKTLAEKAAWKFAEENGLDVVTLHPGFVIGPLLQPTLNLTSEALLNLVRERKTIMDKWNIPILDVRDVALAHILAFENPSA

HMMPanther: PTHR10366:SF9
2-243 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

EKVVCVTGASGYIASWLVKFLLHRGYTVKATVRNLSDPRKVEHLMALEGAKERLFLYQADLLEEGSFDSVVDACECVFHTASPVFLSVSDPRTELIDPAVKGTINVLRSCKKVPSIKRVVITSSMASVMFNHSPLNSDAIVDETWYSDPLFCEEKKEWYALSKTLAEKAAWKFAEENGLDVVTLHPGFVIGPLLQPTLNLTSEALLNLVRERKTIMDKWNIPILDVRDVALAHILAFENPSA

HMMPanther: PTHR10366
2-243 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

EKVVCVTGASGYIASWLVKFLLHRGYTVKATVRNLSDPRKVEHLMALEGAKERLFLYQADLLEEGSFDSVVDACECVFHTASPVFLSVSDPRTELIDPAVKGTINVLRSCKKVPSIKRVVITSSMASVMFNHSPLNSDAIVDETWYSDPLFCEEKKEWYALSKTLAEKAAWKFAEENGLDVVTLHPGFVIGPLLQPTLNLTSEALLNLVRERKTIMDKWNIPILDVRDVALAHILAFENPSA

Gene3D: G3DSA:3.40.50.720
IPR016040
3-217 no description
NAD(P)-binding domain

KVVCVTGASGYIASWLVKFLLHRGYTVKATVRNLSDPRKVEHLMALEGAKERLFLYQADLLEEGSFDSVVDACECVFHTASPVFLSVSDPRTELIDPAVKGTINVLRSCKKVPSIKRVVITSSMASVMFNHSPLNSDAIVDETWYSDPLFCEEKKEWYALSKTLAEKAAWKFAEENGLDVVTLHPGFVIGPLLQPTLNLTSEALLNLVRERKTIM

HMMPfam: PF01370
IPR001509
5-241 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGASGYIASWLVKFLLHRGYTVKATVRNLSDPRKVEHLMALEGAKERLFLYQADLLEEGSFDSVVDACECVFHTASPVFLSVSDPRTELIDPAVKGTINVLRSCKKVPSIKRVVITSSMASVMFNHSPLNSDAIVDETWYSDPLFCEEKKEWYALSKTLAEKAAWKFAEENGLDVVTLHPGFVIGPLLQPTLNLTSEALLNLVRERKTIMDKWNIPILDVRDVALAHILAFENP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox