PRGDB00080488 (Mgu.8678)

From PRG Wiki
Jump to: navigation, search
Mgu.8678
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 238201144 (GR075972)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Cucumis x hytivus

Comment?

CCIF12242.b1 CCIF Mimulus guttatus IM62 leaves (H) Mimulus guttatus cDNA clone CCIF12242 5', mRNA sequence

DNA Sequence

ATCAGTTTGGCTGTCCACAGAAACCTCCTCCGACTTTGGGGCTTCTGCTCTAACGAAAACGAACGCCTCCTAATTTACCCTTACATGTCAAACGGCAGCGTTGCATCAAGGCTTAAAGATAATATAAATGGAAGGCCCGTTTTAGATTGGTCGAGGAGGAAGAGCATAGCACTCGGTACGGCTAGGGGATTGGTGTACTTGCACGAGCAATGTGACCCTAAAGTAATCCACCGCGATGTGAAGGCGGCCAATATTTTATTGGACGAAGATTTCGAGGCGGTGGTGGGTGATTTTGGACTGGGCAAGCTATTGGACCATCGGGATTCTCATGTTACAACCGCGGTGCGTGGGACCCTCGGCCACATTGCACCCGAGTACTTGTCAACCGGCCAATCCTCGGAAAAAACGGACGTATTTGGATTTGGAATCTTGCTTCTTGAGCTCATCACGGGCCATAAGGCGGTGGATTTTGGGCGGGGGGCGAACCAAAAAGGGGTGATTCTTGATTGGGTTAAGAAGCTTCATCAAGAGGGGAAGTTGAATCTAATGGTGGACAAAGAACTAAAGAGCGATTTCGACATGATCGAACTGGAAGAAATGGTGCAGTGGCGCTACTGTGCACCCACTTTAATCCTACGCATCGCCCTAAAATGTCGGAAGTTTTGAGAATGCTCGAAAGGAGATGGATTAGCAGAAAAGTGGGAGCAATCGCAAAAAGTCGACACTCCGAGGTACAACAACAGCAGATCGTTTCAAATCTGCCGCAAAGATATTCCCGATTAT


Protein sequences

Name Description Sequence
Mgu.8678 translated coding region predicted by ESTScan from UniGene Mgu.8678

ISLAVHRNLLRLWGFCSNENERLLIYPYMSNGSVASRLKDNINGRPVLDWSRRKSIALGTARGLVYLHEQCDPKVIHRDVKAANILLDEDFEAVVGDFGLGKLLDHRDSHVTTAVRGTLGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKAVDFGRGANQKGVILDWVKKLHQEGKLNLMVDKELKSDFDMIELEEMVQWRYCAPTLILRIALKCRKFXECSKGDGLAEKWEQSQKVDTPRYNNSRSFQICRKDIPDY

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-261 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

ISLAVHRNLLRLWGFCSNENERLLIYPYMSNGSVASRLKDNINGRPVLDWSRRKSIALGTARGLVYLHEQCDPKVIHRDVKAANILLDEDFEAVVGDFGLGKLLDHRDSHVTTAVRGTLGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKAVDFGRGANQKGVILDWVKKLHQEGKLNLMVDKELKSDFDMIELEEMVQWRYCAPTLILRIALKCRKFXECSKGDGLAEKWEQSQKVDTPRYNNSRSFQICRKDIPDY

HMMPanther: PTHR24420:SF851
1-202 SUBFAMILY NOT NAMED

ISLAVHRNLLRLWGFCSNENERLLIYPYMSNGSVASRLKDNINGRPVLDWSRRKSIALGTARGLVYLHEQCDPKVIHRDVKAANILLDEDFEAVVGDFGLGKLLDHRDSHVTTAVRGTLGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKAVDFGRGANQKGVILDWVKKLHQEGKLNLMVDKELKSDFDMIELEEMVQ

HMMPanther: PTHR24420
1-202 FAMILY NOT NAMED,FAMILY NOT NAMED

ISLAVHRNLLRLWGFCSNENERLLIYPYMSNGSVASRLKDNINGRPVLDWSRRKSIALGTARGLVYLHEQCDPKVIHRDVKAANILLDEDFEAVVGDFGLGKLLDHRDSHVTTAVRGTLGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKAVDFGRGANQKGVILDWVKKLHQEGKLNLMVDKELKSDFDMIELEEMVQ

HMMSmart: SM00219
IPR020635
1-214 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

ISLAVHRNLLRLWGFCSNENERLLIYPYMSNGSVASRLKDNINGRPVLDWSRRKSIALGTARGLVYLHEQCDPKVIHRDVKAANILLDEDFEAVVGDFGLGKLLDHRDSHVTTAVRGTLGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKAVDFGRGANQKGVILDWVKKLHQEGKLNLMVDKELKSDFDMIELEEMVQWRYCAPTLILRI

HMMSmart: SM00220
IPR002290
3-216 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LAVHRNLLRLWGFCSNENERLLIYPYMSNGSVASRLKDNINGRPVLDWSRRKSIALGTARGLVYLHEQCDPKVIHRDVKAANILLDEDFEAVVGDFGLGKLLDHRDSHVTTAVRGTLGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKAVDFGRGANQKGVILDWVKKLHQEGKLNLMVDKELKSDFDMIELEEMVQWRYCAPTLILRIAL

HMMPfam: PF00069
IPR017442
5-167 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

VHRNLLRLWGFCSNENERLLIYPYMSNGSVASRLKDNINGRPVLDWSRRKSIALGTARGLVYLHEQCDPKVIHRDVKAANILLDEDFEAVVGDFGLGKLLDHRDSHVTTAVRGTLGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKAVDFGRGANQKGVI

Gene3D: G3DSA:1.10.510.10
5-160 no description

VHRNLLRLWGFCSNENERLLIYPYMSNGSVASRLKDNINGRPVLDWSRRKSIALGTARGLVYLHEQCDPKVIHRDVKAANILLDEDFEAVVGDFGLGKLLDHRDSHVTTAVRGTLGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKAVDFGRG

superfamily: SSF56112
IPR011009
6-203 Protein kinase-like (PK-like)
Protein kinase-like domain

HRNLLRLWGFCSNENERLLIYPYMSNGSVASRLKDNINGRPVLDWSRRKSIALGTARGLVYLHEQCDPKVIHRDVKAANILLDEDFEAVVGDFGLGKLLDHRDSHVTTAVRGTLGHIAPEYLSTGQSSEKTDVFGFGILLLELITGHKAVDFGRGANQKGVILDWVKKLHQEGKLNLMVDKELKSDFDMIELEEMVQW

PatternScan: PS00108
IPR008271
75-87 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDVKAANILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox