PRGDB00080509 (Mgu.9425)

From PRG Wiki
Jump to: navigation, search
Mgu.9425
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 238207758 (GR082718)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Cucumis x hytivus

Comment?

CCIF15949.b1 CCIF Mimulus guttatus IM62 leaves (H) Mimulus guttatus cDNA clone CCIF15949 5', mRNA sequence

DNA Sequence

GACGGAATCTTTGACCCAACATAACATCACAATCGCCCCCGTCGGAACCACAAAGTTTCACAATATTTGGGTGGATTACGACGGCTTTAAGATGGTCCTCGACGTGTATATCGCAGAACAGGCAAATTTACGTGGTGAGACTCCACCAAAGCCCGAATACCCCATATTATCAGCCAATTTGAATCTGAGAGATCATGTGAATCAGCACTCGTACTTTGGCTTCTCGGCTTCCAATGGGAATGCTTCCCAATTGTACAGTGTGGTGAGGTGGAATTTGAATGTGCACCACTTCTCTGATCCTAATACGAAAATTACTAAATCGGTCAACATAATGCGGGGGGCTGGGCCAGCTGTACTGGTGGTGATGTTGCTGCTGCTATTGGCTGCAGTCTGGTTCGGATATCGTTTCTACAAGAATCGGGTGGCGGCTTTGAATGGCGGCTTGGTGGAGGCACTGAGACTTCTGCCTGGAATGCCCAGAGAGTTCAAGTTCAAGGACCTAAAAAAGTCAACAAACAATTTCGATGAGAAGAACAAGCTTGGACAGGGAGGATTCGGAGTGGTGTACAAAGGGACTCTAGTCGAAGAAACGATGGAAATTGCGGTCAAGTGGTTTTCCAGGGAGAGTATCAAAGGTCAGCACGATTTCCTGGCCGAGCTCACCATTATTAATCGTCTCCGCCACAAGCATCTCGTCAAATTACTTGGATGGTGCCACAAGAATGGGAAGCTGCTGCTCGTATACGAGTACATGCCAAACGGAAGCCTAGACCAGCACCTCTTGTCGGGCCAGAAAAGAGCC


Protein sequences

Name Description Sequence
Mgu.9425 translated coding region predicted by ESTScan from UniGene Mgu.9425

XTESLTQHNITIAPVGTTKFHNIWVDYDGFKMVLDVYIAEQANLRGETPPKPEYPILSANLNLRDHVNQHSYFGFSASNGNASQLYSVVRWNLNVHHFSDPNTKITKSVNIMRGAGPAVLVVMLLLLLAAVWFGYRFYKNRVAALNGGLVEALRLLPGMPREFKFKDLKKSTNNFDEKNKLGQGGFGVVYKGTLVEETMEIAVKWFSRESIKGQHDFLAELTIINRLRHKHLVKLLGWCHKNGKLLLVYEYMPNGSLDQHLLSGQKRA

Domains

Domain Start-End Description Sequence

superfamily: SSF49899
IPR008985
4-198 Concanavalin A-like lectins/glucanases
Concanavalin A-like lectin/glucanase

SLTQHNITIAPVGTTKFHNIWVDYDGFKMVLDVYIAEQANLRGETPPKPEYPILSANLNLRDHVNQHSYFGFSASNGNASQLYSVVRWNLNVHHFSDPNTKITKSVNIMRGAGPAVLVVMLLLLLAAVWFGYRFYKNRVAALNGGLVEALRLLPGMPREFKFKDLKKSTNNFDEKNKLGQGGFGVVYKGTLVEET

Gene3D: G3DSA:2.60.120.200
IPR013320
17-107 no description
Concanavalin A-like lectin/glucanase, subgroup

TTKFHNIWVDYDGFKMVLDVYIAEQANLRGETPPKPEYPILSANLNLRDHVNQHSYFGFSASNGNASQLYSVVRWNLNVHHFSDPNTKITK

HMMPfam: PF00139
IPR001220
19-93 Lectin_legB
Legume lectin, beta chain

KFHNIWVDYDGFKMVLDVYIAEQANLRGETPPKPEYPILSANLNLRDHVNQHSYFGFSASNGNASQLYSVVRWNL

HMMPanther: PTHR24420
22-261 FAMILY NOT NAMED,FAMILY NOT NAMED

NIWVDYDGFKMVLDVYIAEQANLRGETPPKPEYPILSANLNLRDHVNQHSYFGFSASNGNASQLYSVVRWNLNVHHFSDPNTKITKSVNIMRGAGPAVLVVMLLLLLAAVWFGYRFYKNRVAALNGGLVEALRLLPGMPREFKFKDLKKSTNNFDEKNKLGQGGFGVVYKGTLVEETMEIAVKWFSRESIKGQHDFLAELTIINRLRHKHLVKLLGWCHKNGKLLLVYEYMPNGSLDQHL

HMMPanther: PTHR24420:SF662
22-261 SUBFAMILY NOT NAMED

NIWVDYDGFKMVLDVYIAEQANLRGETPPKPEYPILSANLNLRDHVNQHSYFGFSASNGNASQLYSVVRWNLNVHHFSDPNTKITKSVNIMRGAGPAVLVVMLLLLLAAVWFGYRFYKNRVAALNGGLVEALRLLPGMPREFKFKDLKKSTNNFDEKNKLGQGGFGVVYKGTLVEETMEIAVKWFSRESIKGQHDFLAELTIINRLRHKHLVKLLGWCHKNGKLLLVYEYMPNGSLDQHL

Seg: seg
118-131 seg

AVLVVMLLLLLAAV

Gene3D: G3DSA:3.30.200.20
159-252 no description

MPREFKFKDLKKSTNNFDEKNKLGQGGFGVVYKGTLVEETMEIAVKWFSRESIKGQHDFLAELTIINRLRHKHLVKLLGWCHKNGKLLLVYEYM

superfamily: SSF56112
IPR011009
164-263 Protein kinase-like (PK-like)
Protein kinase-like domain

KFKDLKKSTNNFDEKNKLGQGGFGVVYKGTLVEETMEIAVKWFSRESIKGQHDFLAELTIINRLRHKHLVKLLGWCHKNGKLLLVYEYMPNGSLDQHLLS

ProfileScan: PS50011
IPR000719
175-268 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDEKNKLGQGGFGVVYKGTLVEETMEIAVKWFSRESIKGQHDFLAELTIINRLRHKHLVKLLGWCHKNGKLLLVYEYMPNGSLDQHLLSGQKRA

HMMPfam: PF07714
IPR001245
178-263 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

KNKLGQGGFGVVYKGTLVEETMEIAVKWFSRESIKGQHDFLAELTIINRLRHKHLVKLLGWCHKNGKLLLVYEYMPNGSLDQHLLS

PatternScan: PS00107
IPR017441
181-204 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGGFGVVYKGTLVEETMEIAVK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox