PRGDB00080514 (Mgu.9751)

From PRG Wiki
Jump to: navigation, search
Mgu.9751
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 238210069 (GR079100)
Gene Class Unknown
Domain Type
Gene Species Cucumis x hytivus

Comment?

CCIF13952.b1 CCIF Mimulus guttatus IM62 leaves (H) Mimulus guttatus cDNA clone CCIF13952 5', mRNA sequence

DNA Sequence

GAGTTTTGCATTTTAGCGACTATCTACCAAGAACCATGGTTTATAGATATTAAGAAGTATTTTACAGGCTGGCCTGATCAAGAGCTAAAGCTTCCCTTAAAACTTATCTACATGTGCCAATGTGGGTTTTACACCTATAGCATTGCTGCCCTCCTTGCTTGGGAAACACGACGAAAGGATTTCTCTGTCATGATGTCTCATCATATTGTTACTGTGATCCTAATTTCTACTTCATACGTCACAAGGTTTTTCCGAATAGGGGCAGTTATTCTCGCACTGCATGATGCCAGTGATGTATTCCTCGAAGCTGCTAAAGTATTCAAGTACTCAGGGAAAGAGTTTGGGGCTAGCCTGTTTTTCGGTTTGTTTGCTTTATCATGGGTTTTACTAAGGCTCATATTCTTCCCTTTTTGGGTCATAAGATCGTCAAGCTACTACTTATGCGAAGTCTTGAACCTGTCAGAAACATACTCCGCCACATTGTATTATCTCTTCAATACAATGTTGTTGACCCTGCTTATTTTTCACATTTACTGGTGGATTCTCATATGCTCAATGATCACAAGACAGCTGAAAAATAGAGGACAAGTCGGTGAAGATATACGTTCAGATTCGGACGATGACTAGTTGGAAATCATCTTCTCTGAGAGGTATGTTAGCTCGGTAAAAAAAATCGTTATGTTTGCGAATGATTGGCTTATTCAATCTGAGAATTTATATTTTTCAGTTGTTGTAATAGGAGAAAGATAGGAATTTCTAGCATAAAGATGAGATTTCTGCATTTATGTCGGACTAAAAACATAAAAAGAAAGAAAAGCTCCATGTAAA


Protein sequences

Name Description Sequence
Mgu.9751 translated coding region predicted by ESTScan from UniGene Mgu.9751

EFCILATIYQEPWFIDIKKYFTGWPDQELKLPLKLIYMCQCGFYTYSIAALLAWETRRKDFSVMMSHHIVTVILISTSYVTRFFRIGAVILALHDASDVFLEAAKVFKYSGKEFGASLFFGLFALSWVLLRLIFFPFWVIRSSSYYLCEVLNLSETYSATLYYLFNTMLLTLLIFHIYWWILICSMITRQLKNRGQVGEDIRSDSDDD


Domains

Domain Start-End Description Sequence

ProfileScan: PS50922
IPR006634
1-192 TLC
TRAM/LAG1/CLN8 homology domain

EFCILATIYQEPWFIDIKKYFTGWPDQELKLPLKLIYMCQCGFYTYSIAALLAWETRRKDFSVMMSHHIVTVILISTSYVTRFFRIGAVILALHDASDVFLEAAKVFKYSGKEFGASLFFGLFALSWVLLRLIFFPFWVIRSSSYYLCEVLNLSETYSATLYYLFNTMLLTLLIFHIYWWILICSMITRQLK

HMMSmart: SM00724
IPR006634
1-192 TRAM, LAG1 and CLN8 homology domains.
TRAM/LAG1/CLN8 homology domain

EFCILATIYQEPWFIDIKKYFTGWPDQELKLPLKLIYMCQCGFYTYSIAALLAWETRRKDFSVMMSHHIVTVILISTSYVTRFFRIGAVILALHDASDVFLEAAKVFKYSGKEFGASLFFGLFALSWVLLRLIFFPFWVIRSSSYYLCEVLNLSETYSATLYYLFNTMLLTLLIFHIYWWILICSMITRQLK

HMMPanther: PTHR12560
5-208 FAMILY NOT NAMED,LONGEVITY ASSURANCE FACTOR 1 (LAG1)

LATIYQEPWFIDIKKYFTGWPDQELKLPLKLIYMCQCGFYTYSIAALLAWETRRKDFSVMMSHHIVTVILISTSYVTRFFRIGAVILALHDASDVFLEAAKVFKYSGKEFGASLFFGLFALSWVLLRLIFFPFWVIRSSSYYLCEVLNLSETYSATLYYLFNTMLLTLLIFHIYWWILICSMITRQLKNRGQVGEDIRSDSDDD

HMMPfam: PF03798
IPR006634
9-184 TRAM_LAG1_CLN8
TRAM/LAG1/CLN8 homology domain

YQEPWFIDIKKYFTGWPDQELKLPLKLIYMCQCGFYTYSIAALLAWETRRKDFSVMMSHHIVTVILISTSYVTRFFRIGAVILALHDASDVFLEAAKVFKYSGKEFGASLFFGLFALSWVLLRLIFFPFWVIRSSSYYLCEVLNLSETYSATLYYLFNTMLLTLLIFHIYWWILIC

Seg: seg
114-126 seg

FGASLFFGLFALS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox