PRGDB00080563 (Mgu.14629)

From PRG Wiki
Jump to: navigation, search
Mgu.14629
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 238208759 (GR080621)
Gene Class Mlo-like
Domain Type MLO
Gene Species Cucumis x hytivus

Comment?

CCIF14787.b1 CCIF Mimulus guttatus IM62 leaves (H) Mimulus guttatus cDNA clone CCIF14787 5', mRNA sequence

DNA Sequence

GTCAAAAACAGCAGAGCAAAAGCTGAAATAGGAAATTGGAAATTGGGAAAAAGAGAAATGGCAGAAGAAGAAGTTCCAAAAGAGAGATATCTTGATCAGACAGCAACATGGGCAGTTGCTGGTGTCTGTGCCGTTATTATTATCCTCTCTATTATCTTGGAGAAGGTCCTCCACAAAGTTGGAACTTGGTTAACAGAGAGGCATAAGAAAGCTCTTTACGAGGCACTGGAAAAGGTTAAAGCAGAGTTGATGGTACTGGGATTCATATCACTACTACTAGTGTTCAGTCAGTATTACATTGCTGAAATATGCATACCTCTCAAAATAGCCGACACTATGTTGCCCTGCCCTGCTAAAATCAAAGACGATGCTAAGGGAACTGATAATCGTCGTAGACTTTTGTCTTATGAACGCCGTTTTTTGGCTGGCCAAAAGAAGAATCCTTGCAAAGCCGGGACTGTACCAATTATTACAGTGACTGGACTGCATCAGATACATATTCTAATATTCTTCTTAGCATGTTTCCACGTCTTTTACAGTGCTGTTACTATGGCTCTTGGTAGACTTAAGATTCGTGGATGGAAACAATGGGAGCAGGAGACTTTGTCACACGACTATGAGTTTACAAATGATCCTTCAAGATTCACGCTTACTCACGAGACATCTTTTGTGAGGGCCCACACTAGTTTCTGGACACGCATTCCGTTGTTCTTTTACATTGGATGCTTTTTTCGACATTTTTTAGTCCGTCAGCAGATCTGATTATTTGACCCTGCGCAATGTTTCATTGCTGTTCATTTGGCCCCGGAAGCAAGTTTAACT


Protein sequences

Name Description Sequence
Mgu.14629 translated coding region predicted by ESTScan from UniGene Mgu.14629

VKNSRAKAEIGNWKLGKREMAEEEVPKERYLDQTATWAVAGVCAVIIILSIILEKVLHKVGTWLTERHKKALYEALEKVKAELMVLGFISLLLVFSQYYIAEICIPLKIADTMLPCPAKIKDDAKGTDNRRRLLSYERRFLAGQKKNPCKAGTVPIITVTGLHQIHILIFFLACFHVFYSAVTMALGRLKIRGWKQWEQETLSHDYEFTNDPSRFTLTHETSFVRAHTSFW

Domains

Domain Start-End Description Sequence

HMMPfam: PF03094
IPR004326
27-231 Mlo
Mlo-related protein

KERYLDQTATWAVAGVCAVIIILSIILEKVLHKVGTWLTERHKKALYEALEKVKAELMVLGFISLLLVFSQYYIAEICIPLKIADTMLPCPAKIKDDAKGTDNRRRLLSYERRFLAGQKKNPCKAGTVPIITVTGLHQIHILIFFLACFHVFYSAVTMALGRLKIRGWKQWEQETLSHDYEFTNDPSRFTLTHETSFVRAHTSFW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox