PRGDB00080576 (Mgu.15315)

From PRG Wiki
Jump to: navigation, search
Mgu.15315
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 238207142 (GR084025)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Cucumis x hytivus

Comment?

CCIF16666.g1 CCIF Mimulus guttatus IM62 leaves (H) Mimulus guttatus cDNA clone CCIF16666 3', mRNA sequence

DNA Sequence

CAAGTGTGATAGATATAACTCAACAAAAATTACAAACAAATTAAATCCCCCCATTTTTTTCTTTCTCAAGCAACAACAACATTAACATGCAAAGGCGACGGCCTCGGGTAATTAGCAGCACCGTTTCTGCCCAAACGTCCCATATTATTATTATTAGTATTATTATAAGTCCTATAATTATGACGACGATGCTGCTGCTGTTGCTGCTGCTGCTTCGGTGGTTCGGTCTTTACGAGAATTCCCGTGTCTTGAAGTTGTTCCAACGCTTTGACGACTTCGGGCATAGTGGGCCTGTATTTGGGCTCTAAAGCTAAGCACTTTACAGCAAGATTTGCTGCCTTTAGTGCTGCCCTTGGAGAGTATTGGCCCTGTATACGAGCATCCATTACTCGTAGTACTTTACGCTTGCTCCCCAAGAATGGTCCCGCCCATTCTAGAAGCTTCTGCTCCCCTTGTGGAAGGTTCTTGTCCAGCACCCTTCGTCCGGTCAGCATCTCGAGAAGAACCACCCCGAAACTGTACACGTCGCTTCTTGCCGTGAGGTGTCCTGTGGCCATGTACTCGGGAGCAGCATAGCCGTAAGTACCCATAACTCGCGTAGAAACGTGACTTTTACCGTCCATCGGCCCATCCTTGGCCAATCCAAAATCAGACAACTTCGCCC


Protein sequences

Name Description Sequence
Mgu.15315 translated coding region predicted by ESTScan from UniGene Mgu.15315

XAKLSDFGLAKDGPMDGKSHVSTRVMGTYGYAAPEYMATGHLTARSDVYSFGVVLLEMLTGRRVLDKNLPQGEQKLLEWAGPFLGSKRKVLRVMDARIQGQYSPRAALKAANLAVKCLALEPKYRPTMPEVVKALEQLQDTGILVKTEPPKQQQQQQQHRRHNYRTYNNTNNNNMGRLGRNGAANYPRPSPLHVNVVVA

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-138 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XAKLSDFGLAKDGPMDGKSHVSTRVMGTYGYAAPEYMATGHLTARSDVYSFGVVLLEMLTGRRVLDKNLPQGEQKLLEWAGPFLGSKRKVLRVMDARIQGQYSPRAALKAANLAVKCLALEPKYRPTMPEVVKALEQL

superfamily: SSF56112
IPR011009
2-135 Protein kinase-like (PK-like)
Protein kinase-like domain

AKLSDFGLAKDGPMDGKSHVSTRVMGTYGYAAPEYMATGHLTARSDVYSFGVVLLEMLTGRRVLDKNLPQGEQKLLEWAGPFLGSKRKVLRVMDARIQGQYSPRAALKAANLAVKCLALEPKYRPTMPEVVKAL

Gene3D: G3DSA:1.10.510.10
2-172 no description

AKLSDFGLAKDGPMDGKSHVSTRVMGTYGYAAPEYMATGHLTARSDVYSFGVVLLEMLTGRRVLDKNLPQGEQKLLEWAGPFLGSKRKVLRVMDARIQGQYSPRAALKAANLAVKCLALEPKYRPTMPEVVKALEQLQDTGILVKTEPPKQQQQQQQHRRHNYRTYNNTNN

HMMPanther: PTHR24420
2-199 FAMILY NOT NAMED,FAMILY NOT NAMED

AKLSDFGLAKDGPMDGKSHVSTRVMGTYGYAAPEYMATGHLTARSDVYSFGVVLLEMLTGRRVLDKNLPQGEQKLLEWAGPFLGSKRKVLRVMDARIQGQYSPRAALKAANLAVKCLALEPKYRPTMPEVVKALEQLQDTGILVKTEPPKQQQQQQQHRRHNYRTYNNTNNNNMGRLGRNGAANYPRPSPLHVNVVVA

HMMPanther: PTHR24420:SF861
2-199 SUBFAMILY NOT NAMED

AKLSDFGLAKDGPMDGKSHVSTRVMGTYGYAAPEYMATGHLTARSDVYSFGVVLLEMLTGRRVLDKNLPQGEQKLLEWAGPFLGSKRKVLRVMDARIQGQYSPRAALKAANLAVKCLALEPKYRPTMPEVVKALEQLQDTGILVKTEPPKQQQQQQQHRRHNYRTYNNTNNNNMGRLGRNGAANYPRPSPLHVNVVVA

HMMPfam: PF00069
IPR017442
3-133 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

KLSDFGLAKDGPMDGKSHVSTRVMGTYGYAAPEYMATGHLTARSDVYSFGVVLLEMLTGRRVLDKNLPQGEQKLLEWAGPFLGSKRKVLRVMDARIQGQYSPRAALKAANLAVKCLALEPKYRPTMPEVVK

Seg: seg
152-158 seg

QQQQQQQ

Seg: seg
159-185 seg

HRRHNYRTYNNTNNNNMGRLGRNGAAN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox